DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and gzma

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_001335166.1 Gene:gzma / 795070 ZFINID:ZDB-GENE-091204-156 Length:257 Species:Danio rerio


Alignment Length:224 Identity:66/224 - (29%)
Similarity:102/224 - (45%) Gaps:31/224 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 ISLRRNGVHVCGGALIREKWILTAAHCVSLGGGQQSYPAKSYNVRVGSIQRLTGGQLVPLSKIII 104
            :|::.|..|.|||.||.::|:||||||     .:.||  .|..|.:||:....|.|     :|.|
Zfish    42 VSIQVNQNHKCGGILIHKEWVLTAAHC-----KEDSY--SSVTVLIGSLSLSKGSQ-----RIAI 94

  Fly   105 HTNYSSSDAVG----SNDLALLELETSVVLNANTNPIDLATERPAAGSQIIFSGWGSSQVDG-SL 164
            | ||...:...    .:|:.|:.|...|  .|....|....:....|::.:..|||::...| ..
Zfish    95 H-NYEIPETFNKKTKKDDIMLIRLSKKV--KAKPYKIPKKEKDVQPGTKCVVRGWGTTDYKGKQA 156

  Fly   165 SHVLQVATRQSLSASDCQTELYLQQ-----EDLLCLSPVDEDFAGLCSGDAGAPASYNNQLVGIA 224
            |..||:.  :.|.....|...|..:     :|:||.... :...|.|.||:|.|......|||:.
Zfish   157 SDKLQML--EVLVVDRVQCNRYYNRNPVITKDMLCAGNT-QQHRGTCLGDSGGPLECEKNLVGVL 218

  Fly   225 AFFVSGCGS-EQPDGYVDVT-QHLEWINE 251
            : ...|||. ::|..|..:: :|:.|||:
Zfish   219 S-GSHGCGDPKKPTVYTLLSKRHITWINK 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 66/224 (29%)
Tryp_SPc 30..249 CDD:214473 63/220 (29%)
gzmaXP_001335166.1 Tryp_SPc 28..247 CDD:238113 66/224 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587684
Domainoid 1 1.000 117 1.000 Domainoid score I5856
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.