DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and zgc:153968

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001070924.1 Gene:zgc:153968 / 768292 ZFINID:ZDB-GENE-061027-211 Length:301 Species:Danio rerio


Alignment Length:235 Identity:75/235 - (31%)
Similarity:108/235 - (45%) Gaps:30/235 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 AEVGSQPHSISLR--RNGVHVCGGALIREKWILTAAHCVSLGGGQQSYPAKSYNVRVGSIQRLTG 93
            |..||.|..:|:.  ..|..:|||.||..:|:|:||.|.      |...|.:..|.:|.:.  ||
Zfish    42 AMAGSWPWQVSIHYIPTGGLLCGGTLINREWVLSAAQCF------QKLTASNLVVHLGHLS--TG 98

  Fly    94 GQLV---PLSKIIIHTNYSSSDAVGSNDLALLELETSVVLNANTNPIDLATERPAAGSQII--FS 153
            ...|   |.|:||.|..|.|  |...||:|||:|.|.|.......|:.|.....:.|...:  .:
Zfish    99 DPNVIHNPASQIINHPKYDS--ATNKNDIALLKLSTPVSFTDYIKPVCLTASGSSLGKGAVSWIT 161

  Fly   154 GWGSSQVDGS-LSHVLQVATRQSLSASDCQTEL-YLQQEDLLCLSPVDEDFAGLCSGDAGAPASY 216
            ||||....|: ....||......:|..||::.. .|..:.::|..| :|...|:|.||.|.|..:
Zfish   162 GWGSINTGGTQFPTTLQEVKIPVVSNGDCKSAYGSLITDGMICAGP-NEGGKGICMGDGGGPLVH 225

  Fly   217 NN--QLV--GIAAFFVSGCGSEQPDG---YVDVTQHLEWI 249
            |:  |.:  |||:|   |.|..||..   :..|:::..||
Zfish   226 NSSEQWIQSGIASF---GRGCAQPKNPGVFTRVSEYESWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 75/235 (32%)
Tryp_SPc 30..249 CDD:214473 73/233 (31%)
zgc:153968NP_001070924.1 Tryp_SPc 35..262 CDD:214473 73/233 (31%)
Tryp_SPc 36..265 CDD:238113 75/235 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587702
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.