DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and TPSAB1

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_003285.2 Gene:TPSAB1 / 7177 HGNCID:12019 Length:275 Species:Homo sapiens


Alignment Length:277 Identity:78/277 - (28%)
Similarity:123/277 - (44%) Gaps:50/277 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLLLVVIVTLGVVQSSRLPAE-------VGSQ-------PHSISLRRNG---VHVCGGALIREKW 59
            ||||.:.|......::..|.:       ||.|       |..:|||.:|   :|.|||:||..:|
Human     4 LLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQW 68

  Fly    60 ILTAAHCVSLGGGQQSYPAKSYNVRVGSIQRLTGGQLVPLSKIIIHTNYSSSDAVGSNDLALLEL 124
            :|||||||    |.......:..|::.........||:|:|:||:|..:.::. :|: |:|||||
Human    69 VLTAAHCV----GPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQ-IGA-DIALLEL 127

  Fly   125 ETSVVLNANTNPIDL--ATERPAAGSQIIFSGWGSSQVDGSL---------------SHVLQVAT 172
            |..|.::::.:.:.|  |:|....|.....:|||....|..|               :|:.....
Human   128 EEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKY 192

  Fly   173 RQSLSASDCQTELYLQQEDLLCLSPVDEDFAGLCSGDAGAPASYNNQLVGIAAFFVS---GCGS- 233
            .......|   ::.:.::|:||......|   .|.||:|.|.........:.|..||   ||.. 
Human   193 HLGAYTGD---DVRIVRDDMLCAGNTRRD---SCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQP 251

  Fly   234 EQPDGYVDVTQHLEWIN 250
            .:|..|..||.:|:||:
Human   252 NRPGIYTRVTYYLDWIH 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 73/259 (28%)
Tryp_SPc 30..249 CDD:214473 71/256 (28%)
TPSAB1NP_003285.2 Tryp_SPc 31..268 CDD:238113 71/248 (29%)
Tryp_SPc 31..267 CDD:214473 70/247 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152883
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.