DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and prss1

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_571783.2 Gene:prss1 / 65223 ZFINID:ZDB-GENE-010131-7 Length:247 Species:Danio rerio


Alignment Length:238 Identity:71/238 - (29%)
Similarity:105/238 - (44%) Gaps:49/238 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PHSISLRRNGVHVCGGALIREKWILTAAHC------VSLGGGQQSYPAKSYNVRVGSIQRLTGG- 94
            |:.:|| .:|.|.|||:||...|:::||||      |.||         .:|:.|      |.| 
Zfish    37 PYQVSL-NSGYHFCGGSLISNLWVVSAAHCYKSRVQVRLG---------EHNIDV------TEGT 85

  Fly    95 -QLVPLSKIIIHTNYSSSDAVGSNDLALLELETSVVLNANTNPIDLATERPAAGSQIIFSGWGSS 158
             |.:...|:|.|.:|:|:..  .||:.|::|.:|..:|:....:.|.:...::|:..:.||||:.
Zfish    86 EQFINSEKVIRHPSYNSNTL--DNDVMLIKLSSSAQINSYVKTVSLPSSCASSGTSCLISGWGNM 148

  Fly   159 QVDGS-LSHVLQVATRQSLSASDCQTELYLQ-QEDLLCLSPVDEDFAGL-------CSGDAGAPA 214
            ...|| ....|.......||.|.|:.....| ..::.|        ||.       |.||:|.|.
Zfish   149 SASGSNYPSRLMCLNAPILSDSTCRNAYPGQISSNMFC--------AGFMEGGKDSCQGDSGGPV 205

  Fly   215 SYNNQLVGIAAFFVSGCGS-EQPDGYVDVTQHLEWI----NEN 252
            ..||||.||.::.. ||.. .:|..|..|.....||    |.|
Zfish   206 VCNNQLQGIVSWGY-GCAQRNKPGVYAKVCNFTTWIRNTMNSN 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 70/236 (30%)
Tryp_SPc 30..249 CDD:214473 67/229 (29%)
prss1NP_571783.2 Tryp_SPc 24..240 CDD:214473 67/229 (29%)
Tryp_SPc 25..243 CDD:238113 69/232 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.