DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and CG18735

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_652645.1 Gene:CG18735 / 59137 FlyBaseID:FBgn0042098 Length:364 Species:Drosophila melanogaster


Alignment Length:246 Identity:68/246 - (27%)
Similarity:107/246 - (43%) Gaps:46/246 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 EVGSQPHSISLRRNGVHVCGGALIREKWILTAAHCVS-----------LGGGQQSYPAKSYNVRV 85
            ||...|..|.|...|...||.:|:.:::.|||||||:           |...:|....|..:.||
  Fly    90 EVHEYPWMIMLMWFGNFYCGASLVNDQYALTAAHCVNGFYHRLITVRLLEHNRQDSHVKIVDRRV 154

  Fly    86 GSIQRLTGGQLVPLSKIIIHTNYSSSDAVGSNDLALLELETSVVLNANTNPIDLATERPA---AG 147
                          |:::||..||:.:.  .:|:||:.....|.|..:.:|:.:.|  |:   ||
  Fly   155 --------------SRVLIHPKYSTRNF--DSDIALIRFNEPVRLGIDMHPVCMPT--PSENYAG 201

  Fly   148 SQIIFSGWGSSQVDGSLSHVLQVATRQSLSASDCQTELYLQQ---EDLLCLSPVDEDFAGLCSGD 209
            ...:.:|||:....|.:|..||......||..:|:...|.:.   ::::|...|::.....|.||
  Fly   202 QTAVVTGWGALSEGGPISDTLQEVEVPILSQEECRNSNYGESKITDNMICAGYVEQGGKDSCQGD 266

  Fly   210 AGAPA-------SYNNQLVGIAAFFVSGCGSEQPDG-YVDVTQHLEWINEN 252
            :|.|.       :|  ||.||.: :..||......| |..|....:||.||
  Fly   267 SGGPMHVLGSGDAY--QLAGIVS-WGEGCAKPNAPGVYTRVGSFNDWIAEN 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 66/244 (27%)
Tryp_SPc 30..249 CDD:214473 64/241 (27%)
CG18735NP_652645.1 Tryp_SPc 82..311 CDD:214473 64/241 (27%)
Tryp_SPc 83..314 CDD:238113 66/244 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457761
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.