DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and si:dkeyp-93a5.2

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_021326346.1 Gene:si:dkeyp-93a5.2 / 571079 ZFINID:ZDB-GENE-131127-18 Length:130 Species:Danio rerio


Alignment Length:108 Identity:30/108 - (27%)
Similarity:44/108 - (40%) Gaps:26/108 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 SLSH--VLQVATRQSLSASDCQTELYLQ-QEDLLCLSPVDEDFAGL-------CSGDAGAPASYN 217
            :|||  .||......:..|||...|... .::::|        |||       |.||:|.|....
Zfish     9 NLSHPRTLQQTVVPVVINSDCNNLLGATITDNMMC--------AGLLQGGKDTCQGDSGGPMVSQ 65

  Fly   218 NQLVGIAAFFVS---GCGSE-QPDGYVDVTQHLEW----INEN 252
            ...|.:.:..:|   .||.. :|..|..|:|:..|    ||:|
Zfish    66 QCSVWVQSGIISKGHDCGQPYEPGVYTRVSQYQNWIMSSINQN 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 29/106 (27%)
Tryp_SPc 30..249 CDD:214473 27/103 (26%)
si:dkeyp-93a5.2XP_021326346.1 Tryp_SPc <9..103 CDD:238113 27/101 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.