DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and KLK10

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001070968.1 Gene:KLK10 / 5655 HGNCID:6358 Length:276 Species:Homo sapiens


Alignment Length:241 Identity:69/241 - (28%)
Similarity:104/241 - (43%) Gaps:39/241 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PAEVGSQPHSISLRRNGVHV-CGGALIREKWILTAAHCVSLGGGQQSYPAKSYNVRVGS--IQRL 91
            |...||||..:|| .||:.. |.|.|:.:.|:||||||.:          |....|||.  :..|
Human    51 PCARGSQPWQVSL-FNGLSFHCAGVLVDQSWVLTAAHCGN----------KPLWARVGDDHLLLL 104

  Fly    92 TGGQLVPLSKIIIHTNYSSSDA------VGSNDLALLELETSVVLNANTNPIDLATERPAAGSQI 150
            .|.||...::.::|..|.....      ...:||.||:|...|||......:.|.......|.|.
Human   105 QGEQLRRTTRSVVHPKYHQGSGPILPRRTDEHDLMLLKLARPVVLGPRVRALQLPYRCAQPGDQC 169

  Fly   151 IFSGWGSSQVDG-SLSHVLQVATRQSLSASDCQTELY--LQQEDLLCLSPVDEDFAGL------C 206
            ..:|||::.... ..:..|..::...||..:|:. .|  :...:::|        |||      |
Human   170 QVAGWGTTAARRVKYNKGLTCSSITILSPKECEV-FYPGVVTNNMIC--------AGLDRGQDPC 225

  Fly   207 SGDAGAPASYNNQLVGIAAFFVSGCGSEQ-PDGYVDVTQHLEWINE 251
            ..|:|.|...:..|.||.::.|..|||.| |..|..:.:::.|||:
Human   226 QSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINK 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 69/241 (29%)
Tryp_SPc 30..249 CDD:214473 66/237 (28%)
KLK10NP_001070968.1 Tryp_SPc 49..272 CDD:238113 69/241 (29%)
Tryp_SPc 49..269 CDD:214473 66/237 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.