DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and PRSS2

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001290343.1 Gene:PRSS2 / 5645 HGNCID:9483 Length:261 Species:Homo sapiens


Alignment Length:261 Identity:80/261 - (30%)
Similarity:129/261 - (49%) Gaps:29/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLLLVVIVTLGVV----QSSRLP----AEVGSQPHSISLRRNGVHVCGGALIREKWILTAAHCV- 67
            |||::..|...|.    ...::.    .|..|.|:.:|| .:|.|.|||:||.|:|:::|.||. 
Human     3 LLLILTFVAAAVAAPFDDDDKIVGGYICEENSVPYQVSL-NSGYHFCGGSLISEQWVVSAGHCYK 66

  Fly    68 -----SLGGGQQSYPAKSYNVRVG--SIQRLTGG-QLVPLSKIIIHTNYSSSDAVGSNDLALLEL 124
                 .|.|....|  ....||:|  :|:.|.|. |.:..:|||.|..|:|...  .||:.|::|
Human    67 SAINSKLSGRGCEY--HRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTL--DNDILLIKL 127

  Fly   125 ETSVVLNANTNPIDLATERPAAGSQIIFSGWGSSQVDGS-LSHVLQVATRQSLSASDCQTELYLQ 188
            .:..|:|:..:.|.|.|..||||::.:.||||::...|: ....||......||.::|:.. |..
Human   128 SSPAVINSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLSQAECEAS-YPG 191

  Fly   189 Q--EDLLCLSPVDEDFAGLCSGDAGAPASYNNQLVGIAAFFVSGCGSE-QPDGYVDVTQHLEWIN 250
            :  .::.|:..: |.....|.||:|.|...|.:|.||.::.. ||..: :|..|..|..:::||.
Human   192 KITNNMFCVGFL-EGGKDSCQGDSGGPVVSNGELQGIVSWGY-GCAQKNRPGVYTKVYNYVDWIK 254

  Fly   251 E 251
            :
Human   255 D 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 75/239 (31%)
Tryp_SPc 30..249 CDD:214473 73/235 (31%)
PRSS2NP_001290343.1 Tryp_SPc 23..253 CDD:214473 73/237 (31%)
Tryp_SPc 24..256 CDD:238113 75/240 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.