DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and PRSS1

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_011514713.1 Gene:PRSS1 / 5644 HGNCID:9475 Length:472 Species:Homo sapiens


Alignment Length:267 Identity:80/267 - (29%)
Similarity:130/267 - (48%) Gaps:36/267 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SPVQSYSHSRLLLLVVIVTLGVVQSSRLP------------AEVGSQPHSISLRRNGVHVCGGAL 54
            |...|.:||..:..::|:|. |..:...|            .|..|.|:.:|| .:|.|.|||:|
Human   215 SSTTSQAHSTTMNPLLILTF-VAAALAAPFDDDDKIVGGYNCEENSVPYQVSL-NSGYHFCGGSL 277

  Fly    55 IREKWILTAAHCVSLGGGQQSYPAKSYNVRVG--SIQRLTGG-QLVPLSKIIIHTNYSSSDAVGS 116
            |.|:|:::|.||         |.:: ..||:|  :|:.|.|. |.:..:|||.|..|.....  :
Human   278 INEQWVVSAGHC---------YKSR-IQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTL--N 330

  Fly   117 NDLALLELETSVVLNANTNPIDLATERPAAGSQIIFSGWGSSQVDGS-LSHVLQVATRQSLSASD 180
            ||:.|::|.:..|:||..:.|.|.|..||.|::.:.||||::...|: ....||......||.:.
Human   331 NDIMLIKLSSRAVINARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAK 395

  Fly   181 CQTELYLQQ--EDLLCLSPVDEDFAGLCSGDAGAPASYNNQLVGIAAFFVSGCGSE-QPDGYVDV 242
            |:.. |..:  .::.|:..: |.....|.||:|.|...|.||.|:.: :..||..: :|..|..|
Human   396 CEAS-YPGKITSNMFCVGFL-EGGKDSCQGDSGGPVVCNGQLQGVVS-WGDGCAQKNKPGVYTKV 457

  Fly   243 TQHLEWI 249
            ..:::||
Human   458 YNYVKWI 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 73/239 (31%)
Tryp_SPc 30..249 CDD:214473 71/237 (30%)
PRSS1XP_011514713.1 Ig 19..119 CDD:299845
IG_like 29..113 CDD:214653
Tryp_SPc 248..464 CDD:214473 70/231 (30%)
Tryp_SPc 249..467 CDD:238113 72/232 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.