DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and LOC560023

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_021325702.1 Gene:LOC560023 / 560023 -ID:- Length:271 Species:Danio rerio


Alignment Length:262 Identity:76/262 - (29%)
Similarity:119/262 - (45%) Gaps:46/262 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLLVVIVTLGVVQSSRLPAEVGSQ---PHSI----SLRRNGVHVCGGALIREKWILTAAHCVSLG 70
            ||.|.:|...:|:.:.....:|.|   |:||    ||:.:..|.|||.||:.:|:||||||..  
Zfish    25 LLWVFLVLAVMVRDAFSQRIIGGQEVVPYSIKYQVSLQVDRKHFCGGTLIQPQWVLTAAHCWR-- 87

  Fly    71 GGQQSYPA-------KSYNVRVGSIQRLTGG--QLVPLSKIIIHTNYSSSDAVGSNDLALLELET 126
                  ||       ..:|:.|..      |  |:..::|:..|..|:..  ..:||:.:::|..
Zfish    88 ------PASVIQVVLSEHNLAVEE------GFEQVCTVAKVFSHVAYNPK--TFNNDIMIIKLTA 138

  Fly   127 SVVLNANTNPIDLAT-ERP--AAGSQIIFSGWGSSQV-DGSLSHVLQVATRQSLSASDCQTELYL 187
            ...:||...|..|.| :.|  |.||....||||.::: :..||.:|:....:..|:  ||...|.
Zfish   139 PAQINAYVQPALLPTADTPELAGGSSCTVSGWGVTRLYNFYLSPILRAVDVEIFSS--CQLYYYY 201

  Fly   188 QQED-LLCLSPVDEDFAG--LCSGDAGAPASYNNQLVGIAAFFVSGCG-SEQPDGYVDVTQHLEW 248
            :..| ::|   ....|.|  .|.||:|.|...:..|.||.::.: ||. ...|..|..|..:..|
Zfish   202 RVNDNMIC---AGSRFGGKDSCQGDSGGPLICDGYLEGIVSWGI-GCALPYYPGVYTKVRNYNRW 262

  Fly   249 IN 250
            |:
Zfish   263 ID 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 71/245 (29%)
Tryp_SPc 30..249 CDD:214473 69/242 (29%)
LOC560023XP_021325702.1 Tryp_SPc 43..263 CDD:214473 69/241 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.