DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and LOC558805

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_021329158.1 Gene:LOC558805 / 558805 -ID:- Length:255 Species:Danio rerio


Alignment Length:263 Identity:68/263 - (25%)
Similarity:120/263 - (45%) Gaps:43/263 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLLLVVIVTLG--------VVQSSRLPAEVGSQPHSISLRRNGVHVCGGALIREKWILTAAHCVS 68
            |||.|.:::|.        ::...:  |:..|..:..|::.||.|.|||.||...::||||||..
Zfish     7 LLLSVTLISLALTGAFGADIINGKK--AKKSSLLYMASVQINGEHKCGGFLIDPSYVLTAAHCNK 69

  Fly    69 LGG-----GQQSYPAKSYNVRVGSIQRLTGGQLVPLSKIIIHTNYSSSDAVGSNDLALLELETSV 128
            .|.     |......|..||:...:|...           ||.:|.|...  ..|:.||:|...|
Zfish    70 QGNMSVILGTHDISPKGTNVKRYRVQNKH-----------IHPSYKSVKT--GKDIMLLKLYKKV 121

  Fly   129 VLNANTNPIDL-ATERP-AAGSQIIFSGWGSSQVDGSLSHVLQVATRQSLSASDCQT-------E 184
            .:..:...:.: :.::| ...|:.:.:|||.::.|.:::.:| |....:::.:.||:       |
Zfish   122 KIGKDVKLVTIPSKDKPLKPKSKCLVAGWGKTEKDNTVNDLL-VTDVLTINKTVCQSVWKKINVE 185

  Fly   185 LYLQQEDLLCLSPVDEDFAGLCSGDAGAPASYNNQLVGIAAFFVSGCG-SEQPDGYVDVTQHLEW 248
            |   .:::||.... |..:|.|.||:|.|...:.|.|||.:|.:..|. ...|:.|..::::..|
Zfish   186 L---PDNILCAGGY-ETKSGACQGDSGGPLVCSGQAVGIVSFNMGRCDYPNTPNIYTQISKYTHW 246

  Fly   249 INE 251
            |.:
Zfish   247 IKK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 63/237 (27%)
Tryp_SPc 30..249 CDD:214473 61/233 (26%)
LOC558805XP_021329158.1 Tryp_SPc 26..250 CDD:238113 63/244 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 117 1.000 Domainoid score I5856
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.