DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and si:dkey-21e2.16

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001038273.1 Gene:si:dkey-21e2.16 / 556598 ZFINID:ZDB-GENE-050208-698 Length:251 Species:Danio rerio


Alignment Length:263 Identity:72/263 - (27%)
Similarity:121/263 - (46%) Gaps:52/263 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLLVVIVTLGVVQSSRLPAEVG------SQPHSISLRRNGVHVCGGALIREKWILTAAHCVSLG- 70
            |||:|.:...:..::|:..|.|      |:|:.:||:..|.|:|||:||.|:::||||||...| 
Zfish     8 LLLLVSLVPDLTYTARVGIEDGTEAKPHSRPYMVSLQIKGWHICGGSLITEQFVLTAAHCWEKGD 72

  Fly    71 -----------GGQQSYPAKSYNVRVGSIQRLTGGQLVPLSKIIIHTNYSSSDAVGSNDLALLEL 124
                       .|.::|  .|::|                :..|.|.:|..|..  .||:.||:|
Zfish    73 VITVVVGAHDLSGNKTY--DSFDV----------------TSYIPHPDYKQSSY--KNDILLLKL 117

  Fly   125 ETSVVLNANTNPIDLATERPAAGSQIIFS--GWGSSQVDGSLSHVLQVATRQSLSASDCQT--EL 185
            ...|.|:.|...|.|..|.....:..:.|  |||...|.|.....|:.|....::..:|:.  |:
Zfish   118 NKKVTLSNNVGLISLPKEGENVEADTLCSVAGWGRLWVRGPRPGHLREADTVIMTDEECKRRWEI 182

  Fly   186 YLQQEDLLCLSPVDEDFAGLCSGDAGAPASYNNQLVGIAAF---FVSGCGSE-QPDGYVDVTQHL 246
            ..:...::|:    ....|.||||:|.|....:.:||:.:|   ::  |.|. :|:.|..::.::
Zfish   183 KFKVSKMICV----YGHGGSCSGDSGGPLVCGDTVVGVTSFTDRYL--CNSRLRPNVYAKISAYI 241

  Fly   247 EWI 249
            .||
Zfish   242 PWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 67/246 (27%)
Tryp_SPc 30..249 CDD:214473 65/244 (27%)
si:dkey-21e2.16NP_001038273.1 Tryp_SPc 26..247 CDD:238113 67/245 (27%)
Tryp_SPc 26..244 CDD:214473 65/243 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 117 1.000 Domainoid score I5856
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.