DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and zgc:112038

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001018482.1 Gene:zgc:112038 / 553673 ZFINID:ZDB-GENE-050522-271 Length:311 Species:Danio rerio


Alignment Length:237 Identity:69/237 - (29%)
Similarity:113/237 - (47%) Gaps:32/237 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 AEVGSQPHSISLRRNGV--HVCGGALIREKWILTAAHC--------VSLGGGQQSYPAKSYNVRV 85
            |..||.|...|:.|...  |:|||:||.:.|:|:||||        :.:..|:|.....:.|   
Zfish    41 AVAGSWPWQASIHRISPEDHICGGSLINKDWVLSAAHCFMITATANIKIFLGRQFQTGSNPN--- 102

  Fly    86 GSIQRLTGGQLVPLSKIIIHTNYSSSDAVGSNDLALLELETSVVLNANTNPIDLATERP--AAGS 148
             .|.|       .|::|:||.:||::  ..:||:|||.|.:||.......|:.||:...  |.|:
Zfish   103 -EISR-------TLTQIVIHPDYSTT--TQNNDIALLRLSSSVTFTDYIRPVCLASADSVFAGGT 157

  Fly   149 QIIFSGWGSSQ-VDGSLSHVLQVATRQSLSASDCQTELY-LQQEDLLCLSPVDEDFAGLCSGDAG 211
            :...:||...: .|..:::|||......:|.::|..:.. :..::::| :.::|.....|.||:|
Zfish   158 KSWITGWDKHRSSDIQVTNVLQEVQLPVVSNTECNADYKGIITDNMIC-AGINEGGKDACQGDSG 221

  Fly   212 APASYNNQLVGIAAFFVS---GCG-SEQPDGYVDVTQHLEWI 249
            .|....|....|.:..||   .|| ...|..|..|:|:..||
Zfish   222 GPMVSQNGSRWIQSGIVSFGRECGLPRYPGIYTRVSQYQSWI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 69/237 (29%)
Tryp_SPc 30..249 CDD:214473 67/235 (29%)
zgc:112038NP_001018482.1 Tryp_SPc 37..263 CDD:214473 67/235 (29%)
Tryp_SPc 37..263 CDD:238113 67/235 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587720
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.