DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and Prss53

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_006230384.1 Gene:Prss53 / 499270 RGDID:1566127 Length:591 Species:Rattus norvegicus


Alignment Length:324 Identity:80/324 - (24%)
Similarity:120/324 - (37%) Gaps:98/324 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QSYSHSRLLLLVVIVTLGVVQSSRL----------PAE----VGSQPHSISLRRNGVHVCGGALI 55
            ||:....|::..|||..|:..:.|.          |.|    .|..|...|:||.|||:|.|:|:
  Rat     3 QSWGPELLIVGAVIVIEGLQAAQRACGQRGPGPPEPQEGNTLPGEWPWQASVRRQGVHICSGSLV 67

  Fly    56 REKWILTAAHCVSLGGGQQSYPAKSYNVRVGSIQR---LTGGQLVPLSKIII---HTNYSSSDAV 114
            .:.|:||||||..   ...:....|::|.:||:::   ..|.:.|.::.:.:   :.:||.    
  Rat    68 ADTWVLTAAHCFE---KMATAELSSWSVVLGSLKQEGLSPGAEEVGVAALQLPKAYNHYSQ---- 125

  Fly   115 GSNDLALLELETSVVLNANTNPI---DLATERPA----AGSQIIFSGWGSSQVDGSL-------- 164
             .:|||||:|         |:||   .|...:|.    .|:....:||..:..||..        
  Rat   126 -GSDLALLQL---------THPIVHTTLCLPQPTHHFPFGASCWATGWDQNTSDGKYCPRHKSRE 180

  Fly   165 SHVLQVATRQSLSASDCQTE-----------------------------LYLQQEDLLCLSP--- 197
            |....|.|..:| .|.|.:|                             ||.:....|..:|   
  Rat   181 SQTGSVLTVLAL-CSHCVSELDSTLSPLPVSRTLRNLRLRLISRPTCNCLYNRLHQRLLANPARS 244

  Fly   198 ------VDEDFAGLCSGDAGAPASYNNQ-----LVGIAAFFVSGCGSEQ-PDGYVDVTQHLEWI 249
                  ......|.|.||:|.|......     .|||.: |.|.|..|. |....|:..|..|:
  Rat   245 GMLCGGAQPGVQGPCQGDSGGPVMCREPDGHWVQVGIIS-FTSNCAQEDTPVLLTDMAAHSSWL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 72/289 (25%)
Tryp_SPc 30..249 CDD:214473 71/287 (25%)
Prss53XP_006230384.1 Tryp_SPc 45..310 CDD:238113 70/282 (25%)
Tryp_SPc 341..561 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.