DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and XB5758585

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001011293.1 Gene:XB5758585 / 496746 XenbaseID:XB-GENE-5758586 Length:248 Species:Xenopus tropicalis


Alignment Length:256 Identity:71/256 - (27%)
Similarity:102/256 - (39%) Gaps:32/256 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VIVTLGVVQSS-----RLPAEVGSQPHS----ISLRRNGVHVCGGALIREKWILTAAHCVSLGGG 72
            |::.||||.:|     ::..|....|||    :.....|...|||:||..:||::||.|      
 Frog     5 VLLFLGVVAASPLVDDKIIGEYECAPHSQKWQVYFTYKGYPWCGGSLISSRWIISAASC------ 63

  Fly    73 QQSYPAKSYNVRVGSIQRLTG-GQLVPLSKIIIHTNY-SSSDAVGSNDLALLELETSVVLNANTN 135
            .||......::....|.|..| .|.:.:.|...|..| ..||   ||::.|::|......|....
 Frog    64 NQSPKYLIAHLGKHDITREEGTEQHIQVEKTFPHNRYLGLSD---SNNIMLVKLAEPAQFNQFVQ 125

  Fly   136 PIDLATERPAAGSQIIFSGWGS-SQVDGSLSHVLQVATRQSLSASDCQTELYLQQE----DLLCL 195
            ||.:|:..|..|.....||:|: :.........||......|..|.|  :.|...:    :|:|.
 Frog   126 PIKVASSCPREGKVCQVSGFGNLNSYAEKYPDRLQCLDLPILPESSC--DAYFSPKKMHTNLMCA 188

  Fly   196 SPVDEDFAGLCSGDAGAPASYNNQLVGIAAFFVSGCGSEQPDGYVDVTQHLEW----INEN 252
            ....:| ...|.||||.|.....:|.||..:.....|...|..|:.|.....|    ||.|
 Frog   189 GFAQDD-KDSCQGDAGGPLICKGELYGIILWGNECSGRGIPGVYLKVCNFTNWMQNIINNN 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 64/236 (27%)
Tryp_SPc 30..249 CDD:214473 62/233 (27%)
XB5758585NP_001011293.1 Tryp_SPc 21..240 CDD:214473 61/230 (27%)
Tryp_SPc 22..244 CDD:238113 62/233 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.