DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and try10

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001011209.1 Gene:try10 / 496640 XenbaseID:XB-GENE-6453489 Length:243 Species:Xenopus tropicalis


Alignment Length:259 Identity:83/259 - (32%)
Similarity:129/259 - (49%) Gaps:40/259 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RLLLLVVIVTLGVVQSSRLPAE-----VG----SQPHSISLRRNGVHVCGGALIREKWILTAAHC 66
            :.|||..::.|.|.|    |.|     ||    |.|:.:||.. |.|.|||:||.|.|:::||||
 Frog     2 KTLLLFSLLGLAVAQ----PIEDDDKIVGGYHCSVPYQVSLNA-GYHFCGGSLINEHWVVSAAHC 61

  Fly    67 VSLGGGQQSYPAKSYNVRVG--SIQRLTG-GQLVPLSKIIIHTNYSSSDAVGSNDLALLELETSV 128
                     |.:| ..:|:|  :|:.|.| .|.:..:|||.|..|:|...  .||:.|::|:...
 Frog    62 ---------YQSK-MELRIGENNIELLEGTEQFIQSAKIIRHPQYNSWTI--DNDIMLIQLQEPA 114

  Fly   129 VLNANTNPIDLATERPAAGSQIIFSGWGSSQVDG-SLSHVLQVATRQSLSASDCQTELYLQQ--E 190
            .||....||.|.||.|..||..:.||||::..:| :...:||......||..:|: :.|...  :
 Frog   115 QLNNEVQPIPLPTECPPVGSICLISGWGNTLSNGVNYPDLLQCIEAPILSDQECR-QSYPGSITD 178

  Fly   191 DLLCLSPVDEDFAGL--CSGDAGAPASYNNQLVGIAAFFVSGCG-SEQPDGYVDVTQHLEWINE 251
            :::|:..::   .|:  |.||:|.|...:.:|.|:.: :..||. ...|..|..|..:|.||.:
 Frog   179 NMICVGYLE---GGIDSCQGDSGGPVVCDGELQGVVS-WGRGCALPGYPGVYTKVCNYLSWIRD 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 77/240 (32%)
Tryp_SPc 30..249 CDD:214473 75/236 (32%)
try10NP_001011209.1 Tryp_SPc 24..239 CDD:238113 75/233 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.