DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and deltaTry

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_523694.2 Gene:deltaTry / 48343 FlyBaseID:FBgn0010358 Length:253 Species:Drosophila melanogaster


Alignment Length:260 Identity:78/260 - (30%)
Similarity:117/260 - (45%) Gaps:30/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLLLVVIVTL-GVVQSSRLP-----------AEVGSQPHSISLRRNGVHVCGGALIREKWILTAA 64
            :||..|...| |.|....||           ..:.|.|..|||:|:|.|.|||::.....|:|||
  Fly     6 ILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAA 70

  Fly    65 HCVSLGGGQQSYPAKSYNVRVGSIQRLTGGQLVPLSKIIIHTNYSSSDAVGSNDLALLELETSVV 129
            ||:      ||..|....:|.||....:||....:|....|..|:::..|  ||:|::::..::.
  Fly    71 HCL------QSVSASVLQIRAGSSYWSSGGVTFSVSSFKNHEGYNANTMV--NDIAIIKINGALT 127

  Fly   130 LNANTNPIDLATERPAAGSQIIFSGWGS-SQVDGSLSHVLQVATRQSLSASDCQTELY----LQQ 189
            .::....|.||:..||.|:....||||: |....|:...||......:|.|.|.:..|    ..:
  Fly   128 FSSTIKAIGLASSNPANGAAASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIR 192

  Fly   190 EDLLCLSPVDEDFAGLCSGDAGAPASYNNQLVGIAAFFVSGCG-SEQPDGYVDVTQHLEWINENA 253
            ..::|.:...:|   .|.||:|.|......|||:.::.. ||. |..|..|.||.....|:..||
  Fly   193 STMICAAASGKD---ACQGDSGGPLVSGGVLVGVVSWGY-GCAYSNYPGVYADVAALRSWVISNA 253

  Fly   254  253
              Fly   254  253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 69/238 (29%)
Tryp_SPc 30..249 CDD:214473 68/235 (29%)
deltaTryNP_523694.2 Tryp_SPc 30..249 CDD:214473 67/230 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.