DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and prtn3

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001006847.1 Gene:prtn3 / 448597 XenbaseID:XB-GENE-5805214 Length:245 Species:Xenopus tropicalis


Alignment Length:275 Identity:75/275 - (27%)
Similarity:118/275 - (42%) Gaps:78/275 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VIVTLGVVQSSRL-------------PAEVGSQPHSISLRRNGVHVCGGALIREKWILTAAHC-- 66
            ::|||.::.:|::             .|...|.|:..||:..|.|.|||:||..::::|||||  
 Frog     5 LLVTLSILWASQVNGGSMHTQIVGGREATPNSHPYIASLQLRGRHFCGGSLIAPQFLMTAAHCME 69

  Fly    67 --------VSLGGGQQSYPAKSYNVRVGSIQRLTGGQLV-----PLSKIIIHTNYSSSDAVGSND 118
                    |.||       |.|......:.||....|:.     ||:.              .||
 Frog    70 NTASNLVTVVLG-------AHSLRANEATKQRFRVNQVFENGFNPLTL--------------QND 113

  Fly   119 LALLELETSVVLNANTNPIDL--ATERPAAGSQIIFSGWGSSQVDGSLSHVLQ----VATRQSLS 177
            :.:|:|:..|.||.....:.|  |.|...||:|.:.:|||....:|.:...||    ..|||:| 
 Frog   114 IVILKLDRPVSLNGKVQVVSLPSANEDVPAGTQCVTAGWGRLSTEGQIPDRLQELNVTVTRQNL- 177

  Fly   178 ASDCQ-----TELYLQQEDLLCLSPVDEDFAGLCSGDAGAPASYNNQLVGIAAFFVSGCGS-EQP 236
               |:     |.:::||             ||:|.||:|.|...|..:.||.:|.:..||: ..|
 Frog   178 ---CRPNNICTGVFMQQ-------------AGICFGDSGGPLVCNGVIQGITSFIIRSCGNGVTP 226

  Fly   237 DGYVDVTQHLEWINE 251
            |.:..|:....:|::
 Frog   227 DFFSRVSLFRRFIDD 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 71/249 (29%)
Tryp_SPc 30..249 CDD:214473 70/245 (29%)
prtn3NP_001006847.1 Tryp_SPc 26..241 CDD:238113 71/252 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.