DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and KLK12

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_062544.1 Gene:KLK12 / 43849 HGNCID:6360 Length:254 Species:Homo sapiens


Alignment Length:237 Identity:64/237 - (27%)
Similarity:104/237 - (43%) Gaps:28/237 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLLLVVIVTLGVVQSSRLP-----AEVG--SQPHSISLRRNGVHVCGGALIREKWILTAAHCVSL 69
            |.:.:::..||:.|:: .|     .|.|  |||..:.|.......|||.||..:|:||||||   
Human     3 LSIFLLLCVLGLSQAA-TPKIFNGTECGRNSQPWQVGLFEGTSLRCGGVLIDHRWVLTAAHC--- 63

  Fly    70 GGGQQSYPAKSYNVRVG--SIQRLTGGQLVPLSKI-IIHTNYSSSDAVGSNDLALLELETSVVLN 131
                   ....|.||:|  |:.:|...:.:..|.. :.|..|..:.....:||.||.|...|.:.
Human    64 -------SGSRYWVRLGEHSLSQLDWTEQIRHSGFSVTHPGYLGASTSHEHDLRLLRLRLPVRVT 121

  Fly   132 ANTNPIDLATERPAAGSQIIFSGWG-SSQVDGSLSHVLQVATRQSLSASDCQTELYLQQ--EDLL 193
            ::..|:.|..:...||::...|||| ::........:||......:|.:.|. .:|..:  .:::
Human   122 SSVQPLPLPNDCATAGTECHVSGWGITNHPRNPFPDLLQCLNLSIVSHATCH-GVYPGRITSNMV 185

  Fly   194 CLSPVDEDFAGLCSGDAGAPASYNNQLVGIAAF-FVSGCGSE 234
            |...|....|  |.||:|.|......|.|:.:: .|..||.:
Human   186 CAGGVPGQDA--CQGDSGGPLVCGGVLQGLVSWGSVGPCGQD 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 60/219 (27%)
Tryp_SPc 30..249 CDD:214473 60/219 (27%)
KLK12NP_062544.1 Tryp_SPc 21..236 CDD:214473 59/218 (27%)
Tryp_SPc 22..236 CDD:238113 59/217 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.