DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and Gm5771

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001034086.1 Gene:Gm5771 / 436523 MGIID:3646222 Length:245 Species:Mus musculus


Alignment Length:231 Identity:73/231 - (31%)
Similarity:117/231 - (50%) Gaps:37/231 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SQPHSISLRRNGVHVCGGALIREKWILTAAHCVSLGGGQQSYPAKSYNVRVG--SIQRLTGG-QL 96
            |.|:.:|| .:|.|.|||:||.::|:::||||         |..: ..||:|  :|:.|.|. |.
Mouse    33 SVPYQVSL-NSGYHFCGGSLINDQWVVSAAHC---------YKTR-IQVRLGEHNIKVLEGNEQF 86

  Fly    97 VPLSKIIIHTNYSSSDAVGSNDLALLELETSVVLNANTNPIDLATERPAAGSQIIFSGWGSSQVD 161
            |..:|||.|.|::....  :||:.|::|.:.|.|||....:.|.:....||:|.:.||||::...
Mouse    87 VNAAKIIKHPNFNRKTL--NNDIMLIKLSSPVTLNARVATVALPSSCAPAGTQCLISGWGNTLSF 149

  Fly   162 G-SLSHVLQVATRQSLSASDCQTELYLQQ--EDLLCLSPVDEDFAGL-------CSGDAGAPASY 216
            | |...:||......|..:||:.. |..:  .:::|        ||.       |.||:|.|...
Mouse   150 GVSEPDLLQCLDAPLLPQADCEAS-YPGKITGNMVC--------AGFLEGGKDSCQGDSGGPVVC 205

  Fly   217 NNQLVGIAAFFVSGCG-SEQPDGYVDVTQHLEWINE 251
            |.:|.||.::.. ||. ::.|..|..|..:::||.:
Mouse   206 NGELQGIVSWGY-GCALADNPGVYTKVCNYVDWIQD 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 73/231 (32%)
Tryp_SPc 30..249 CDD:214473 71/227 (31%)
Gm5771NP_001034086.1 Tryp_SPc 22..238 CDD:214473 71/227 (31%)
Tryp_SPc 23..241 CDD:238113 73/231 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.