DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and CG9733

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_651784.2 Gene:CG9733 / 43601 FlyBaseID:FBgn0039759 Length:418 Species:Drosophila melanogaster


Alignment Length:254 Identity:69/254 - (27%)
Similarity:109/254 - (42%) Gaps:40/254 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 EVGSQPHSISL---RRNG---VHVCGGALIREKWILTAAHCVSLGGGQQSYPAKSYNVRVGSIQR 90
            :|...|..:.|   ||:|   ...|.|:||..:::||||||  |.|..:.......:||:|....
  Fly   169 DVNEFPWMVLLEYRRRSGNGLSTACAGSLINRRYVLTAAHC--LTGRIEREVGTLVSVRLGEHDT 231

  Fly    91 LT-------GGQLVP------LSKIIIHTNYSSSDAVGSNDLALLELETSVVLNANTNPIDLAT- 141
            .|       ||...|      ..:|.:|..||...:...:|:.|:.:|.:|..:.|..||.|.: 
  Fly   232 RTAVDCPPGGGSCSPEVQRLGFEEIRVHERYSEKASNQVHDIGLIRMERNVRYSDNIQPICLPSS 296

  Fly   142 ---ERPAAGSQIIFSGWGSSQVDGSLSHVLQVATRQSLSASDC-----QTELYLQQEDLLCLSPV 198
               |...:|.|...:|||.: :..:.|.|.|..|...:..:.|     |.::.|:...|......
  Fly   297 VGLESRQSGQQFTVAGWGRT-LKMARSAVKQKVTVNYVDPAKCRQRFSQIKVNLEPTQLCAGGQF 360

  Fly   199 DEDFAGLCSGDAGAP-ASYNNQ---LVGIAAFFVSGCG-SEQPDGYVDVTQHLEWINEN 252
            .:|   .|.||:|.| ..:.::   |.||.:|... || .:.|..|.:|..:..||.:|
  Fly   361 RKD---SCDGDSGGPLMRFRDESWVLEGIVSFGYK-CGLKDWPGVYTNVAAYDIWIRQN 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 68/252 (27%)
Tryp_SPc 30..249 CDD:214473 66/249 (27%)
CG9733NP_651784.2 CLIP 25..78 CDD:288855
Tryp_SPc 161..412 CDD:214473 66/249 (27%)
Tryp_SPc 162..415 CDD:238113 68/252 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457349
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.