DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and CG11836

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster


Alignment Length:245 Identity:65/245 - (26%)
Similarity:104/245 - (42%) Gaps:43/245 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PAEVGSQPHSISLRRNGVHVCGGALIREKWILTAAHCVS----------LGGGQQSYPAKSYNVR 84
            |..|...|....:..:|...|||:|:.:.::|:|||||.          .|...|...::|.   
  Fly   102 PTGVNQYPWMARIVYDGKFHCGGSLLTKDYVLSAAHCVKKLRKSKIRVIFGDHDQEITSESQ--- 163

  Fly    85 VGSIQRLTGGQLVPLSKIIIHTNYSSSDAVGSNDLALLELETSVVLNANTNPIDLATER--PAA- 146
              :|||       .::.:|.|.::...  ..:||:|||.|...:..:....||.|....  ||. 
  Fly   164 --AIQR-------AVTAVIKHKSFDPD--TYNNDIALLRLRKPISFSKIIKPICLPRYNYDPAGR 217

  Fly   147 -GSQIIFSGWGSSQVDGSLSHVLQVATRQSLSASDCQTELYLQ---QEDLLCLSPVDEDFAGLCS 207
             |:.:   |||.:...|.|..::.......:|.::|:.:.|..   ...:||......|   .|.
  Fly   218 IGTVV---GWGRTSEGGELPSIVNQVKVPIMSITECRNQRYKSTRITSSMLCAGRPSMD---SCQ 276

  Fly   208 GDAGAPASYNNQ----LVGIAAFFVSGCGSE-QPDGYVDVTQHLEWINEN 252
            ||:|.|...:|.    :|||.::.| |||.| .|..|..|::.:.||..|
  Fly   277 GDSGGPLLLSNGVKYFIVGIVSWGV-GCGREGYPGVYSRVSKFIPWIKSN 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 64/243 (26%)
Tryp_SPc 30..249 CDD:214473 62/240 (26%)
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 64/243 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457759
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.