DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and CG5255

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:261 Identity:77/261 - (29%)
Similarity:125/261 - (47%) Gaps:38/261 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLLLVVIVTLGVVQSSRLP-------------AEVGSQPHSISLR--RNGVHVCGGALIREKWIL 61
            :||.:|:.|.........|             |..|..|:.|||:  .:|.|.||||:|.|:||:
  Fly     4 ILLPLVLFTSSAASQILYPPQYTKNRIVGGEEAAAGLAPYQISLQGIGSGAHSCGGAIIDERWII 68

  Fly    62 TAAHCVSLGGGQQSYPAKSYNVRVGSIQRL--TGGQLVPLSKIIIHTNYSSSDAVGSNDLALLEL 124
            |||||..   |:|   |.::.|..|: |.|  .|.:.....:|:.|:||:....  .||:|||.|
  Fly    69 TAAHCTR---GRQ---ATAFRVLTGT-QDLHQNGSKYYYPDRIVEHSNYAPRKY--RNDIALLHL 124

  Fly   125 ETSVVLNANTNPIDLATERPAAGSQIIFSGWGSSQVDGSLSHVLQ------VATRQSLSASDCQT 183
            ..|:|.:..|.|::|..|....||:::.:|||:..:.|.:...||      |...|..:|.|..|
  Fly   125 NESIVFDNATQPVELDHEALVPGSRLLLTGWGTLSLGGDVPARLQSLEVNYVPFEQCRAAHDNST 189

  Fly   184 ELYLQQEDLLCLSPVDEDFAGLCSGDAGAPASYNNQLVGIAAFFVSGCGSEQPDGYVDVTQHLEW 248
            .:     |:..:...::...|.|.||:|.|..:|.:||.:..:.:. |....||.:..::.:.::
  Fly   190 RV-----DIGHVCTFNDKGRGACHGDSGGPLVHNGKLVALVNWGLP-CAKGYPDAHASISYYHDF 248

  Fly   249 I 249
            |
  Fly   249 I 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 73/243 (30%)
Tryp_SPc 30..249 CDD:214473 72/241 (30%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 71/234 (30%)
Tryp_SPc 30..252 CDD:238113 72/235 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.