DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and CG17475

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:220 Identity:69/220 - (31%)
Similarity:110/220 - (50%) Gaps:11/220 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 EVGSQPHSISLR-RNGVHVCGGALIREKWILTAAHCVSLGGGQQSYPAKSYNVRVGSIQRLTGGQ 95
            ::|...:.|||: ..|.|:|||.:|.|:.:|||||||      ..|......|..|:::......
  Fly    57 QLGEAKYQISLQGMYGGHICGGCIIDERHVLTAAHCV------YGYNPTYLRVITGTVEYEKPDA 115

  Fly    96 LVPLSKIIIHTNYSSSDAVGSNDLALLELETSVVLNANTNPIDLATERPAAGSQIIFSGWGSSQV 160
            :..:.:..||.||:|.|.  .||:||:.|..::..|..|.|.:|.|...|.|:|::.:||||:::
  Fly   116 VYFVEEHWIHCNYNSPDY--HNDIALIRLNDTIKFNEYTQPAELPTAPVANGTQLLLTGWGSTEL 178

  Fly   161 DGSLSHVLQVATRQSLSASDCQTELYLQQEDLLC-LSPVDEDFAGLCSGDAGAPASYNNQLVGIA 224
            .|....:||.|....:..|.||..:.....:..| :..:.....|.|.||:|.|.::|..|.|:.
  Fly   179 WGDTPDILQKAYLTHVVYSTCQEIMNNDPSNGPCHICTLTTGGQGACHGDSGGPLTHNGVLYGLV 243

  Fly   225 AFFVSGCGSEQPDGYVDVTQHLEWI 249
            .:... |....||.:.:|..:||||
  Fly   244 NWGYP-CALGVPDSHANVYYYLEWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 69/220 (31%)
Tryp_SPc 30..249 CDD:214473 67/218 (31%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 67/218 (31%)
Tryp_SPc 50..269 CDD:238113 69/220 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.