DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and CG12951

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_649880.1 Gene:CG12951 / 41110 FlyBaseID:FBgn0037677 Length:265 Species:Drosophila melanogaster


Alignment Length:264 Identity:78/264 - (29%)
Similarity:134/264 - (50%) Gaps:33/264 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLLLVVIVTLG--------VVQSSRLPAEVGSQPHSISLRR-NGVHVCGGALIREKWILTAAHCV 67
            |::::.:.|:|        ||..:  .:.|...|..:|||. :|.|.|||::|.:.:::|||||.
  Fly    11 LIVILAVTTVGQAAPSISRVVNGT--DSSVLKYPFVVSLRSYDGSHSCGGSIISKHFVMTAAHCT 73

  Fly    68 SLGGGQQSYPAKSYNVRVG--SIQRLTGGQLVPLSKIIIHTNYSSSDAVGSNDLALLELETSVVL 130
            :      ..||.:.:::.|  :|..: |..:|.:.|||.|.::..: ...:||::||.:|.....
  Fly    74 N------GRPADTLSIQFGVTNISAM-GPNVVGIKKIIQHEDFDPT-RQNANDISLLMVEEPFEF 130

  Fly   131 N-ANTNPIDL-----ATERPAAGSQIIFSGWGSSQVDGSLSHVLQVATRQSLSASDCQTELYLQQ 189
            : .:..|::|     |..:..||.:.:..|||.:...||:...||..:.:..|..:| |..:..|
  Fly   131 DGVSVAPVELPALAFAVPQSDAGVEGVLIGWGLNDTYGSVQDTLQEVSLKIYSDEEC-TSRHNGQ 194

  Fly   190 ED---LLCLSPVDEDFAGLCSGDAGAPASYNNQLVGIAAFFVSGCG-SEQPDGYVDVTQHLEWIN 250
            .|   .:| ..|||...|.||||:|.|..||.|.|||.::.:..|. :..|..|..|:|:::||.
  Fly   195 TDPKYHIC-GGVDEGGKGQCSGDSGGPLIYNGQQVGIVSWSIKPCTVAPYPGVYCKVSQYVDWIK 258

  Fly   251 ENAV 254
            .|.:
  Fly   259 SNQI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 72/234 (31%)
Tryp_SPc 30..249 CDD:214473 70/231 (30%)
CG12951NP_649880.1 Tryp_SPc 29..257 CDD:214473 72/239 (30%)
Tryp_SPc 30..260 CDD:238113 74/241 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.