DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and Sp7

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_649734.2 Gene:Sp7 / 40918 FlyBaseID:FBgn0037515 Length:391 Species:Drosophila melanogaster


Alignment Length:281 Identity:72/281 - (25%)
Similarity:110/281 - (39%) Gaps:73/281 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LPAEVGSQPHSISLRRNGVH---------------------------VCGGALIREKWILTAAHC 66
            ||:.....|||.|   |.|:                           .|||:||..:::||||||
  Fly   122 LPSPPKCGPHSFS---NKVYNGNDTAIDEFNWMALLEYVDNRGRRELSCGGSLINNRYVLTAAHC 183

  Fly    67 VSLGGGQQSYPAKSYNVRVGS---------IQRLTGGQLVPL--SKIIIHTNYSSSDAVGSNDLA 120
            |.  |..::.......||:|.         |..:....::.|  .:..:|..|..::....:|:|
  Fly   184 VI--GAVETEVGHLTTVRLGEYDTSKDVDCIDDICNQPILQLGIEQATVHPQYDPANKNRIHDIA 246

  Fly   121 LLELETSVVLNANTNPI--DLATERPA--AGSQIIFSGWGSSQVDGSLSHVLQVATRQSLSASD- 180
            ||.|:..||||....|:  .|.:.|.|  .|..::.||||.:    :.:....:..|..|..:| 
  Fly   247 LLRLDRPVVLNEYIQPVCLPLVSTRMAINTGELLVVSGWGRT----TTARKSTIKQRLDLPVNDH 307

  Fly   181 --CQTELYLQQEDL----LCLSPVDEDFAGLCSGDAGAP--------ASYNNQLVGIAAFFVSGC 231
              |..:...:...|    ||:.  .|.:...|.||:|.|        |.|...:|.    |.:.|
  Fly   308 DYCARKFATRNIHLISSQLCVG--GEFYRDSCDGDSGGPLMRRGFDQAWYQEGVVS----FGNRC 366

  Fly   232 GSE-QPDGYVDVTQHLEWINE 251
            |.| .|..|..|..:::||.|
  Fly   367 GLEGWPGVYTRVADYMDWIVE 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 71/280 (25%)
Tryp_SPc 30..249 CDD:214473 68/276 (25%)
Sp7NP_649734.2 CLIP 31..84 CDD:288855
Tryp_SPc 136..385 CDD:214473 62/260 (24%)
Tryp_SPc 137..388 CDD:238113 65/263 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457355
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.