DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and Try10

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001004097.1 Gene:Try10 / 408247 RGDID:1359400 Length:246 Species:Rattus norvegicus


Alignment Length:224 Identity:71/224 - (31%)
Similarity:112/224 - (50%) Gaps:23/224 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 SQPHSISLRRNGVHVCGGALIREKWILTAAHCVSLGGGQQSYPAKSYNVRVG--SIQRLTGG-QL 96
            |.|:.:|| .:|.|.|||:||.|:|:::||||         |.:: ..||:|  :|..|.|. |.
  Rat    34 SVPYQVSL-NSGYHFCGGSLINEQWVVSAAHC---------YKSR-IQVRLGEHNINVLEGNEQF 87

  Fly    97 VPLSKIIIHTNYSSSDAVGSNDLALLELETSVVLNANTNPIDLATERPAAGSQIIFSGWGSSQVD 161
            |..:|||.|.|:.....  :||:.|::|.:.|.||:....:.|.:....||:|.:.||||::...
  Rat    88 VNAAKIIKHPNFIRKTL--NNDIMLIKLSSPVKLNSRVATVALPSSCAPAGTQCLISGWGNTLSF 150

  Fly   162 G-SLSHVLQVATRQSLSASDCQTELYLQQEDLLCLSPVDEDFAGLCSGDAGAPASYNNQLVGIAA 225
            | :...:||......|..:||:.....:..|.:..:...|.....|.||:|.|...|.:|.||.:
  Rat   151 GVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCAGFLEGGKDSCQGDSGGPVVCNGELQGIVS 215

  Fly   226 FFVSGCGSEQPDG---YVDVTQHLEWINE 251
            :   |.|...||.   |..|..:::||.:
  Rat   216 W---GYGCALPDNPGVYTKVCNYVDWIQD 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 71/224 (32%)
Tryp_SPc 30..249 CDD:214473 69/220 (31%)
Try10NP_001004097.1 Tryp_SPc 23..239 CDD:214473 69/220 (31%)
Tryp_SPc 24..242 CDD:238113 71/224 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.