DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and Tmprss11c

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001003979.1 Gene:Tmprss11c / 408213 RGDID:1302967 Length:418 Species:Rattus norvegicus


Alignment Length:231 Identity:69/231 - (29%)
Similarity:109/231 - (47%) Gaps:21/231 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 AEVGSQPHSISLRRNGVHVCGGALIREKWILTAAHCVSLGGGQQSYPAKSYNVRVGSIQRLTGGQ 95
            ||.|..|...||::|.||.||..||...|::|||||.     .:|...|.:.|..|.:......|
  Rat   193 AEEGEWPWQASLQQNNVHRCGATLISNSWLITAAHCF-----VRSANPKDWKVSFGFLLSKPQAQ 252

  Fly    96 LVPLSKIIIHTNYSSSDAVGSNDLALLELETSVVLNANTNPIDL--ATERPAAGSQIIFSGWGSS 158
            .. :..|:||.|||.  ...:||:|::.|.:.|:...|.....|  ||::....|.::.:|||:.
  Rat   253 RA-VKSIVIHENYSY--PAHNNDIAVVRLSSPVLYENNIRRACLPEATQKFPPNSDVVVTGWGTL 314

  Fly   159 QVDGSLSHVLQVATRQSLSASDCQT-ELY--LQQEDLLCLSPVDEDFAGLCSGDAGAP-ASYNNQ 219
            :.||...::||....:.:....|.: :.|  :....:||...: |.....|.||:|.| .|.:::
  Rat   315 KSDGDSPNILQKGRVKIIDNKTCNSGKAYGGVITPGMLCAGFL-EGRVDACQGDSGGPLVSEDSK 378

  Fly   220 LVGIAAFFVSGCGSE-----QPDGYVDVTQHLEWIN 250
            .:...|..|| .|.|     :|..|..||.:.:||:
  Rat   379 GIWFLAGIVS-WGDECALPNKPGVYTRVTHYRDWIS 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 69/231 (30%)
Tryp_SPc 30..249 CDD:214473 67/228 (29%)
Tmprss11cNP_001003979.1 SEA 62..157 CDD:279699
Tryp_SPc 186..412 CDD:214473 67/228 (29%)
Tryp_SPc 187..415 CDD:238113 69/231 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.