DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and Sems

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster


Alignment Length:234 Identity:59/234 - (25%)
Similarity:97/234 - (41%) Gaps:52/234 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 AEVGSQPHSISLRRNGVHVCGGALIREKWILTAAHCVSLGGGQQSYPAKSYNVRVGSIQRLT-GG 94
            |::|.  :.:::|.....:|||.||.|..:||||||......::::...      |.|.||: .|
  Fly    53 AKLGG--YLVAMRYFNNFICGGTLIHELIVLTAAHCFEDRAEKEAWSVD------GGISRLSEKG 109

  Fly    95 QLVPLSKIIIHTNYSSSDAVGSNDLALLELETSVVL------NANTNPIDLATERPAAGSQIIFS 153
            ....:.:.|....:.         :..:.::.:|||      ..|...:.|.:.....|..:..|
  Fly   110 IRRQVKRFIKSAQFK---------MVTMNMDVAVVLLNRPMVGKNIGTLSLCSTALTPGQTMDVS 165

  Fly   154 GWGSSQVD----GSLSHVLQV----------ATRQSLSASDCQTELYLQQEDLLCLSPVDEDFAG 204
            |||.:..|    |.:...:.|          |.|:|:|.||          .:.|.|.:.:..| 
  Fly   166 GWGMTNPDDEGPGHMLRTVSVPVIEKRICREAYRESVSISD----------SMFCASVLGKKDA- 219

  Fly   205 LCSGDAGAPASYNNQLVGIAAFFVSGCGSEQ-PDGYVDV 242
             |:.|:|.|..|..|:.||.:|.: ||.|.: |..|.||
  Fly   220 -CTYDSGGPLVYEKQVCGIVSFGI-GCASRRYPGVYTDV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 59/234 (25%)
Tryp_SPc 30..249 CDD:214473 59/234 (25%)
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 59/234 (25%)
Tryp_SPc 44..265 CDD:238113 59/234 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.