DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and CG6462

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster


Alignment Length:251 Identity:69/251 - (27%)
Similarity:103/251 - (41%) Gaps:56/251 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 GSQPHSISL--RRNGVHV--CGGALIREKWILTAAHCVSLGGGQQSYPAKSYNVRV------GSI 88
            |..|:.:.|  :.:|..:  |||:||..:::||||||::     .:..||.|....      .|:
  Fly    86 GMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLT-----DAIAAKIYTGATVFADVEDSV 145

  Fly    89 QRLTGGQLVPLSKIIIHTNYSSSDAVGSNDLALLELETSVVLNANTNPIDLATE----RPAAGSQ 149
            :.|.    |.....||:.:|....  |.:||||:.|...|..:....||:||.|    ....|..
  Fly   146 EELQ----VTHRDFIIYPDYLGFG--GYSDLALIRLPRKVRTSEQVQPIELAGEFMHQNFLVGKV 204

  Fly   150 IIFSGWGSSQVDGSLSHVLQVATR--QSLSASDCQTELYLQQEDLLC------------LSPVDE 200
            :..|||      |.|.......||  |.|.|.      .:.||..:|            |.....
  Fly   205 VTLSGW------GYLGDSTDKRTRLLQYLDAE------VIDQERCICYFLPGLVSQRRHLCTDGS 257

  Fly   201 DFAGLCSGDAGAPASYN----NQLVGIAAF-FVSGCGSEQPDGYVDVTQHLEWINE 251
            :..|.|:||:|.|..|:    :.|:|:.:| ...||....|..|..:|.:|.||.:
  Fly   258 NGRGACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGCEVGGPTVYTRITAYLPWIRQ 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 69/251 (27%)
Tryp_SPc 30..249 CDD:214473 67/247 (27%)
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 67/247 (27%)
Tryp_SPc 77..314 CDD:238113 69/251 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473228
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.