DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and CG14990

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster


Alignment Length:262 Identity:62/262 - (23%)
Similarity:112/262 - (42%) Gaps:37/262 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 GVVQSSRLPAEV---GSQPHSISLRRNGVHVCGGALIREKWILTAAHCVSLGGGQQSYPAKSYNV 83
            |:|.:.::|.:.   |..|..::|...|.:...|:||..:.:||||..| :|........::...
  Fly    55 GLVANVKVPKDYSTPGQFPWVVALFSQGKYFGAGSLIAPEVVLTAASIV-VGKTDAEIVVRAGEW 118

  Fly    84 RVGSIQRLTGGQLVPLSKIIIHTNYSSSDAVGSNDLALLELETSVVLNANTNPIDLATE-RPAAG 147
            ..|........:..|:::::.|..:|.  .:|:|::|||.|.....|.::...|.|.:: |....
  Fly   119 NTGQRSEFLPSEDRPVARVVQHREFSY--LLGANNIALLFLANPFELKSHIRTICLPSQGRSFDQ 181

  Fly   148 SQIIFSGWGSSQV-DGSLSHVLQVATRQSLSASDCQTEL--------YLQQEDLLCLSPVDEDFA 203
            .:.:.:|||.... |.:.|::.:......::.:.||.:|        :.....|:|..  .|..|
  Fly   182 KRCLVTGWGKVAFNDENYSNIQKKIELPMINRAQCQDQLRNTRLGVSFDLPASLICAG--GEKDA 244

  Fly   204 GLCSGDAGA---------PASYNNQLVGIAAFFVSGCGSEQ-PDGYVDVTQHLEWI------NEN 252
            |.|.||.|:         |:.|  :..||..:.: ||..|. |..|.:|....:||      |.|
  Fly   245 GDCLGDGGSALFCPMEADPSRY--EQAGIVNWGI-GCQEENVPAVYTNVEMFRDWIYEHMAQNSN 306

  Fly   253 AV 254
            :|
  Fly   307 SV 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 58/250 (23%)
Tryp_SPc 30..249 CDD:214473 55/241 (23%)
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 56/240 (23%)
Tryp_SPc 67..297 CDD:214473 54/237 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457597
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.