DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and CG32277

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster


Alignment Length:216 Identity:61/216 - (28%)
Similarity:98/216 - (45%) Gaps:26/216 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 HS--ISLRRNGVHVCGGALIREKWILTAAHCVSLGGGQQSYPAKSYNVRVGSIQRLTGGQLVP-- 98
            ||  ::|||.|...|||.:|....:||||||:. |..||     ..::.|.:.|:..|..:.|  
  Fly    38 HSFLVNLRRGGKFRCGGVIISPNCVLTAAHCLE-GRYQQ-----VRDLTVHAQQQCLGDDMPPEH 96

  Fly    99 ---LSKIIIHTNYSSSDAVGSNDLALLELET--SVVLNANTNPIDLATERPAAGSQIIFSGWGSS 158
               ...:.:..||.:...:.| |||::.|..  .:..||:...||.....|.:...::  |||:.
  Fly    97 VRSAWYVGLSPNYCAQRGLDS-DLAVIRLSRPFDIAGNASLVKIDYNDLPPHSNLTVL--GWGAI 158

  Fly   159 QVDG-SLSHVLQVATRQSLSASDCQTEL----YLQQEDLLCLSPVDEDFAGLCSGDAGAPASYNN 218
            ...| :.:..||.|..:.:|..:|...:    .....::.|  .:.::....|.||:|.||.|..
  Fly   159 NEQGHNWNQCLQEANVKLISHRECIKSVGSGWQKVTNNMFC--ALGKNARDACQGDSGGPAIYAG 221

  Fly   219 QLVGIAAFFVSGCGSEQPDGY 239
            :.|||.::.. ||||..|..|
  Fly   222 RSVGIVSWGY-GCGSGYPGVY 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 61/216 (28%)
Tryp_SPc 30..249 CDD:214473 61/216 (28%)
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 61/216 (28%)
Tryp_SPc 27..246 CDD:238113 61/216 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25869
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.