DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and CG3650

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_611971.1 Gene:CG3650 / 37974 FlyBaseID:FBgn0035070 Length:249 Species:Drosophila melanogaster


Alignment Length:243 Identity:67/243 - (27%)
Similarity:111/243 - (45%) Gaps:26/243 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLLVVIVTLGVVQSSRLPAEVGSQPHSIS--------LRRNGVHVCGGALIREKWILTAAHCVSL 69
            ||.:..:.||:......|..||....::|        ||.:|...|||:|:....::|||||:  
  Fly     7 LLQLTQLLLGLASGQIQPRIVGGTTTTLSAVGGFVVNLRYDGTFYCGGSLVTSSHVVTAAHCL-- 69

  Fly    70 GGGQQSYPAKSYNVRVGSIQRLT-GGQLVPLSKIIIHTNYSSSDAVGSNDLALLELETSVVLNAN 133
                :.|.|....|: |.:.:|: .|.:..:::..|...:|||..  :.|:.::.|: |.:..:.
  Fly    70 ----KGYQASRITVQ-GGVSKLSQSGVVRRVARYFIPNGFSSSSL--NWDVGVIRLQ-SALTGSG 126

  Fly   134 TNPIDLATERPAAGSQIIFSGWGSSQV-DGSLSHVLQVATRQSLSASDCQTELYLQQEDLLCLSP 197
            ...|.|...:...|:.:..||||:::. :.|.|:.|:....|.:....||..  .|..|.|..|.
  Fly   127 ITTIPLCQVQWNPGNYMRVSGWGTTRYGNSSPSNQLRTVRIQLIRKKVCQRA--YQGRDTLTAST 189

  Fly   198 VDEDFAG--LCSGDAGAPASYNNQLVGIAAFFVSGCGSEQ-PDGYVDV 242
            ......|  .||||:|....:.|||.||.::.: ||.:.| |..|..|
  Fly   190 FCARTGGKDSCSGDSGGGVIFKNQLCGIVSWGL-GCANAQYPGVYTSV 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 63/226 (28%)
Tryp_SPc 30..249 CDD:214473 63/226 (28%)
CG3650NP_611971.1 Tryp_SPc 25..243 CDD:214473 62/225 (28%)
Tryp_SPc 26..243 CDD:238113 62/224 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.