DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and CG9897

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001286753.2 Gene:CG9897 / 37651 FlyBaseID:FBgn0034807 Length:265 Species:Drosophila melanogaster


Alignment Length:279 Identity:81/279 - (29%)
Similarity:126/279 - (45%) Gaps:59/279 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLLLVVI----VTLG---VVQSSRLPAEVGSQPHSISLRRNGVHVCGGALIREKWILTAAHCVSL 69
            |:||.::    :.||   ::..:.:  .:...|...|:..|....||||:|.:.:|||||.||  
  Fly     5 LILLQIVALPWLALGDQRIINGNTV--NIKDAPWYASIIVNSKLKCGGAIISKNYILTAAKCV-- 65

  Fly    70 GGGQQSYPAKSYNVRVGSIQRLTGGQLVPLSKIIIHTNYSSSDAVGSNDLALLELETSVVLNA-- 132
                ..|.|:|..||:|:....|.|.:..:.|:.:|:.|||...  .|:|||  |:|..:||.  
  Fly    66 ----DGYSARSIQVRLGTSSCGTSGSIAGICKVKVHSQYSSWRF--DNNLAL--LKTCELLNTTD 122

  Fly   133 NTNPIDLATERPAAGSQIIFSGWGSSQ-------VDGSLS--------------HVLQVATRQSL 176
            ...||:.|.:.|...|:...:|.|...       :|..:|              |..||   :.|
  Fly   123 EIKPIERADKVPDDNSRANVTGCGGRSGNFLDLILDLRISSGIEEKCFQLPVQLHGTQV---RIL 184

  Fly   177 SASDCQTE-----LYLQQ--EDL-LCLSPVDEDFAGLCSGDAGAPASYNNQLVGIAAFFVSGCGS 233
            |...|..:     .||.:  .|| :|.....:   |.||.|.|:|...:|:||||.:  .:|| |
  Fly   185 SQKQCAADWKVIPFYLLKGISDLTICTKSPGK---GACSTDRGSPLVIDNKLVGILS--RAGC-S 243

  Fly   234 EQPDGYVDVTQHLEWINEN 252
            .:||.|.::..|..|::.|
  Fly   244 IKPDVYANILGHTNWLDSN 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 75/252 (30%)
Tryp_SPc 30..249 CDD:214473 74/249 (30%)
CG9897NP_001286753.2 Tryp_SPc 22..258 CDD:214473 74/256 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.