DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and CG32833

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_726278.1 Gene:CG32833 / 37650 FlyBaseID:FBgn0052833 Length:268 Species:Drosophila melanogaster


Alignment Length:243 Identity:67/243 - (27%)
Similarity:115/243 - (47%) Gaps:39/243 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PAEVGSQP--HSISLRRNGVHVCGGALIREKWILTAAHCVSLGGGQQSYPAKSYNVRVGSIQRLT 92
            |..:.:.|  .|||:::..  .|.||:.:...|:||..||      ..:..|...|||||..|..
  Fly    43 PVNITTAPWIASISIKQKA--KCDGAIYKLSHIVTAGKCV------DGFLNKVIRVRVGSTTRSD 99

  Fly    93 GGQLVPLSKIIIHTNYSSSDAVGSNDLALLELETSVVLNANTNPIDLATERPAAGSQIIFSGWGS 157
            |...|.:..|.:|..::.....  :::|:|:|...:..:....||.||.:.|:.|:::..:||.|
  Fly   100 GVIEVAVCNITVHEKFTGQTVF--HNVAILKLCEPLEASKTIQPIQLANQLPSNGAKVTANGWPS 162

  Fly   158 SQ---------VDGSLSHVLQVATRQSLSASDCQTELYLQQ--------EDLLCLSPVDEDFA-G 204
            .:         :|.. ::.||.|..:.|..|.| |:|:.:.        :||.|    .|.|| .
  Fly   163 FRWWAMYWKKCLDDE-AYKLQKAEVKLLGPSQC-TDLWARNNWSKKNFTDDLFC----TEKFAKE 221

  Fly   205 LCSGDAGAPASYNNQLVGIAAFFVSGCGSEQPDGYVDVTQHLEWINEN 252
            .||...|:|..:|.:||||..  ..|| ||.|:.|:::.::.:|::.:
  Fly   222 ACSLAMGSPVVHNGKLVGIIT--KGGC-SEYPEVYINLIKYKDWLHNH 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 67/241 (28%)
Tryp_SPc 30..249 CDD:214473 66/238 (28%)
CG32833NP_726278.1 Tryp_SPc 40..266 CDD:238113 67/241 (28%)
Tryp_SPc 40..262 CDD:214473 66/237 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.