DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and CG11192

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_611479.2 Gene:CG11192 / 37309 FlyBaseID:FBgn0034507 Length:279 Species:Drosophila melanogaster


Alignment Length:247 Identity:76/247 - (30%)
Similarity:115/247 - (46%) Gaps:45/247 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 AEVGSQPHSISLRRNGVHVCGGALIREKWILTAAHCVSLGGGQQSYPAKSYNVRVGSIQRLTGGQ 95
            |.:...|:.:|::..|.|:||||:|....:||||||.     :..:.:..|.|||||.:..:||.
  Fly    34 ATIQEFPYQVSVQLQGRHICGGAIIGIDTVLTAAHCF-----EDPWSSADYTVRVGSSEHESGGH 93

  Fly    96 LVPLSKIIIHTNYS--SSDAVGSNDLALLELETSVVLNANTNPIDLA--TERPAAGSQIIFSGWG 156
            ::.|.::|.|.:|:  |.|    ||||||.|...:....:..|:.||  .:.|.|.:::..||||
  Fly    94 VLSLRRVIAHGDYNPQSHD----NDLALLILNGQLNFTEHLQPVPLAALADPPTADTRLQVSGWG 154

  Fly   157 ----SSQVDG--SLSHVLQVATRQSLSASDCQTELYLQ----QEDLLCLSPVDEDFAGLCSGDAG 211
                .|.|.|  .:|..|:......:.::.|: ..|.|    ...::|.:....|   .|.||:|
  Fly   155 FQAEESAVSGEVGVSPQLRFVDVDLVESNQCR-RAYSQVLPITRRMICAARPGRD---SCQGDSG 215

  Fly   212 APASYNNQLVGIAA--------FFVS---GCGSEQ-PDGYVDVTQHLEWINE 251
            .|      |||.||        ..||   ||.:.. |..|.:|.....||:|
  Fly   216 GP------LVGYAAEEGPARLYGIVSWGLGCANPNFPGVYTNVAAFRSWIDE 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 76/247 (31%)
Tryp_SPc 30..249 CDD:214473 73/243 (30%)
CG11192NP_611479.2 Tryp_SPc 27..259 CDD:214473 73/243 (30%)
Tryp_SPc 28..262 CDD:238113 76/247 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.