DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and thetaTry

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster


Alignment Length:265 Identity:77/265 - (29%)
Similarity:125/265 - (47%) Gaps:35/265 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 HSRLLLLVVIV-------TLGVVQSSRLPAE----------VGSQPHSISLR-RNGVHVCGGALI 55
            |..::|||.:.       |:||........|          :|:.|:.:||: ::|.|.|||:||
  Fly     2 HRLVVLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLI 66

  Fly    56 REKWILTAAHCVSLGGGQQSYPAKSYNVRVGSIQRLTGGQLVPLSKIIIHTNYSSSDAVGSNDLA 120
            .|..::|||||  |.|.:.|   |.: ||:||.....||.:|.:.::..:.:|:|...  ..|:.
  Fly    67 NEDTVVTAAHC--LVGRKVS---KVF-VRLGSTLYNEGGIVVAVRELAYNEDYNSKTM--EYDVG 123

  Fly   121 LLELETSVVLNANTNPIDLATERPAAGSQIIFSGWGSSQVDG--SLSHVLQVATRQSLSASDCQT 183
            :|:|:..|....|...|:||||.|..|:..:.:||||.....  :|...||......:....|.:
  Fly   124 ILKLDEKVKETENIRYIELATETPPTGTTAVVTGWGSKCYFWCMTLPKTLQEVYVNIVDWKTCAS 188

  Fly   184 ELY----LQQEDLLCLSPVDEDFAGLCSGDAGAPASYNNQLVGIAAFFVSGCGSEQPDGYVDVTQ 244
            :.|    :..:.::|.....:|   .|.||:|.|.:..|.||||.::..:...:..|..|.||..
  Fly   189 DEYKYGEIIYDSMVCAYEKKKD---ACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSDVPA 250

  Fly   245 HLEWI 249
            ..:||
  Fly   251 LRKWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 70/237 (30%)
Tryp_SPc 30..249 CDD:214473 68/235 (29%)
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 67/231 (29%)
Tryp_SPc 35..255 CDD:238113 67/230 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.