DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and etaTry

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster


Alignment Length:264 Identity:80/264 - (30%)
Similarity:122/264 - (46%) Gaps:41/264 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLLLVVIVTLGVVQSS-----RLPAEVGSQPHS-------ISLRRNG------VHVCGGALIREK 58
            |.:|.|:..||:...|     |:   ||....|       :.|||..      ...|||.::...
  Fly     6 LRILAVLFLLGIYAVSAQSDGRI---VGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAV 67

  Fly    59 WILTAAHCVSLGGGQQSYPAKSYNVRVGSIQRLTGGQ---LVPLSKIIIHTNYSSSDAVGSNDLA 120
            .|.||||||      .:..|:::.|..|...|  ||.   :|.:||:|.|..|:||..  .||:|
  Fly    68 TIATAAHCV------YNREAENFLVVAGDDSR--GGMNGVVVRVSKLIPHELYNSSTM--DNDIA 122

  Fly   121 LLELETSVVLN--ANTNPIDLATERPAAGSQIIFSGWGSSQVDGSLSHVLQVATRQSLSASDCQT 183
            |:.::..:.|:  :....|::|:|:||.|.|...||||.::.:|..|..||......:.:..||.
  Fly   123 LVVVDPPLPLDSFSTMEAIEIASEQPAVGVQATISGWGYTKENGLSSDQLQQVKVPIVDSEKCQE 187

  Fly   184 ELYLQ--QEDLLCLSPVDEDFAGLCSGDAGAPASYNNQLVGIAAFFVSGCG-SEQPDGYVDVTQH 245
            ..|.:  .|.:|| :.:.|.....|.||:|.|....|:|.||.: :..||. ...|..|.:|..:
  Fly   188 AYYWRPISEGMLC-AGLSEGGKDACQGDSGGPLVVANKLAGIVS-WGEGCARPNYPGVYANVAYY 250

  Fly   246 LEWI 249
            .:||
  Fly   251 KDWI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 73/241 (30%)
Tryp_SPc 30..249 CDD:214473 71/239 (30%)
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 72/241 (30%)
Tryp_SPc 28..257 CDD:238113 73/242 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.