DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and CG8738

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_610403.1 Gene:CG8738 / 35855 FlyBaseID:FBgn0033321 Length:459 Species:Drosophila melanogaster


Alignment Length:229 Identity:56/229 - (24%)
Similarity:96/229 - (41%) Gaps:29/229 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 GVHVCGGALIREKWILTAAHCVSLGGGQQSYPAKSYNVRVGSIQRLTGGQLVPLSKIIIHTNYSS 110
            |..||||.||..:.:||:||.| ....:.|...::.:..:.|...|...|:..:|::..|.|:::
  Fly   224 GNFVCGGTLIHPQLVLTSAHNV-FNRSEDSLLVRAGDWDLNSQTELHPYQMRAISELHRHENFNN 287

  Fly   111 SDAVGSNDLALLELETSVVLNANTNPIDL-ATERPAAGSQI-----IFSGWG-SSQVDGSLSHVL 168
            ....  ||:||:.||....:..:..||.| ..|.|...:::     :.:||| ......::.::|
  Fly   288 LTLY--NDIALVVLERPFQVAPHIQPICLPPPETPQMEAELRSASCLATGWGLRYSTSRTMENLL 350

  Fly   169 QVATRQSLSASDCQTEL--------YLQQEDLLCLSPV-DEDFAGLCSGDAGAP-------ASYN 217
            :.....::....||..|        |.......|...| .:|   .|.||.|:|       ....
  Fly   351 KRIELPAVDHESCQRLLRHTVLGRRYNLHPSFTCAGGVKGKD---TCMGDGGSPLFCTLPGQKDR 412

  Fly   218 NQLVGIAAFFVSGCGSEQPDGYVDVTQHLEWINE 251
            .||||:.::.:.....:.|..|.:|.....||:|
  Fly   413 YQLVGLVSWGIECAEKDVPAAYTNVAYLRNWIDE 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 56/229 (24%)
Tryp_SPc 30..249 CDD:214473 53/225 (24%)
CG8738NP_610403.1 Tryp_SPc 207..447 CDD:238113 56/229 (24%)
Tryp_SPc 207..444 CDD:214473 53/225 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457451
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.