DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and CG8586

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster


Alignment Length:249 Identity:59/249 - (23%)
Similarity:98/249 - (39%) Gaps:75/249 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 VCGGALIREKWILTAAHCV---------------SLGGGQQSYPAKSYNVRVGSIQRLTGGQLVP 98
            :|||.||..:.::|.:|.:               .|....:.||.:...::              
  Fly   213 LCGGTLIHPRLVVTTSHNLVNETVDTLVARAGDWDLNSLNEPYPHQGSRIK-------------- 263

  Fly    99 LSKIIIHTNYSSSDAVGSNDLALLELETSVVLNANTNPIDL-ATERPAAGSQII-----FSGWGS 157
              :||:|:.:..:...  ||:|||.|:..:.|..:..|:.| ..|.|...:|::     .:|||:
  Fly   264 --EIIMHSEFDPNSLY--NDIALLLLDEPIRLAPHIQPLCLPPPESPELTNQLLSVTCYATGWGT 324

  Fly   158 SQVDGS--LSHVLQVATRQSLSASDCQTEL--------YLQQEDLLCLSPVDEDFAG------LC 206
            .:. ||  |.|||:......:...:||.:|        :..:...:|        ||      .|
  Fly   325 KEA-GSDKLEHVLKRINLPLVEREECQAKLRNTRLEARFRLRPSFIC--------AGGDPGKDTC 380

  Fly   207 SGDAGAPA---------SYNNQLVGIAAFFVSGCGSEQPDGYVDVTQHLEWINE 251
            .||.|:|.         .|  |||||.::.|.....:.|..||:|.....||:|
  Fly   381 KGDGGSPLFCQMPGEMDRY--QLVGIVSWGVECAVEDIPAVYVNVPHLRGWIDE 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 59/249 (24%)
Tryp_SPc 30..249 CDD:214473 56/245 (23%)
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 59/249 (24%)
Tryp_SPc 197..430 CDD:214473 56/245 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457445
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.