DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and CG18478

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_609764.1 Gene:CG18478 / 34923 FlyBaseID:FBgn0028517 Length:294 Species:Drosophila melanogaster


Alignment Length:268 Identity:70/268 - (26%)
Similarity:105/268 - (39%) Gaps:61/268 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VIVTLGVVQSSRLPAEVGSQPHSISLRRNGVHVCGGALIREKWILTAAHCV-------------- 67
            |.|...|.:....|||.   |.:|::..|...|.||:||....:|||||.:              
  Fly    39 VKVQFNVTEGQAKPAEF---PWTIAVIHNRSLVGGGSLITPDIVLTAAHRIFNKDVEDIVVSAGE 100

  Fly    68 -SLGGGQQSYPAKSYNVRVGSIQRLTGGQLVPLSKIIIHTNYSSSDAVGSNDLALLELETSVVLN 131
             ..|...:.||.:...|                .|::||.:::...  |:|:||||.|:....|.
  Fly   101 WEYGSALEKYPFEEAFV----------------LKMVIHKSFNYQR--GANNLALLFLDREFPLT 147

  Fly   132 ANTNPIDLATE-RPAAGSQIIFSGWGSSQV-DGSLSHVLQVATRQSLSASDCQTEL--------Y 186
            ...|.|.|.|: |..:.::.|.:|||..|. |.....||:......:....||.:|        |
  Fly   148 YKINTICLPTQKRSLSSTRCIVAGWGKYQFSDTHYGGVLKKIDLPIVPRHICQDQLRKTRLGQNY 212

  Fly   187 LQQEDLLCLSPVDEDFAGLCSGDAGA---------PASYNNQLVGIAAFFVSGCGSEQ-PDGYVD 241
            .....|:|.....::.|  |:||.|.         |..:  :.:||..:.| ||..:. |..|.|
  Fly   213 TLPRGLICAGGEKDNDA--CTGDGGGALFCPMTEDPKQF--EQIGIVNWGV-GCKEKNVPATYTD 272

  Fly   242 VTQHLEWI 249
            |.:...||
  Fly   273 VFEFKPWI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 67/255 (26%)
Tryp_SPc 30..249 CDD:214473 65/253 (26%)
CG18478NP_609764.1 Tryp_SPc 50..283 CDD:238113 67/257 (26%)
Tryp_SPc 50..280 CDD:214473 65/255 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457585
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.