DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and Phae1

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001285870.1 Gene:Phae1 / 34637 FlyBaseID:FBgn0263234 Length:270 Species:Drosophila melanogaster


Alignment Length:272 Identity:74/272 - (27%)
Similarity:122/272 - (44%) Gaps:47/272 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SRLLLLVVI-----VTLG-----VVQSSRLPAEVGSQPHSISLRRNGVHVCGGALIREKWILTAA 64
            |.||||:.|     |.:|     ||..|  ||.|.|.|:::|::..|.|.|..:::...|::|||
  Fly    13 SGLLLLLGICRISGVAIGAPEGRVVGGS--PAAVNSAPYAVSMQYGGTHYCAASILNANWLVTAA 75

  Fly    65 HCVSLGGGQQSYPAKSYNVRVGSIQRLTGGQLV-----------PLSKIIIHTNYSSSDAVGSND 118
            ||::           :.|..:||  .|..|.:.           .::..:|:..|:....  ..|
  Fly    76 HCLT-----------NSNQVLGS--TLVAGSIAVDGTASTTQTRSITYFVINDLYTGGTV--PYD 125

  Fly   119 LALLELETSVVLNANTNPIDLATERPAAGSQIIFSGWGSSQVDGSLSH--VLQVATR-QSLSASD 180
            :.::...|:.|.:|...|:.|.:............||||:....:.|:  .|||||. ..:|.|.
  Fly   126 IGMIYTPTAFVWSAAVAPVTLPSSGVVPTGTANLYGWGSTSTTNTASYPSTLQVATNVPIISLSS 190

  Fly   181 CQTELYLQQEDL----LCLSPVDEDFAGLCSGDAGAPASYNNQLVGIAAFFVSGCG-SEQPDGYV 240
            |::.|..:..|:    ||..|:... ..:|:.|:|.|....|.|:||.::....|| :..|..||
  Fly   191 CESALGTKGSDVHSTNLCTGPLTGG-VSICTSDSGGPLVQGNVLIGIVSWGKLPCGQANSPSVYV 254

  Fly   241 DVTQHLEWINEN 252
            .|:..:.||:.|
  Fly   255 QVSSFISWISAN 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 62/240 (26%)
Tryp_SPc 30..249 CDD:214473 60/237 (25%)
Phae1NP_001285870.1 Tryp_SPc 35..263 CDD:214473 63/245 (26%)
Tryp_SPc 36..266 CDD:238113 65/247 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.