DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and Try29F

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster


Alignment Length:260 Identity:82/260 - (31%)
Similarity:124/260 - (47%) Gaps:42/260 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLVVIVTLG-VVQSSRLPAE-VGSQ-------PHSISLRRNGVHVCGGALIREKWILTAAHCVSL 69
            :|:|.::|| .|:..||... ||.|       |:.:||:|: .|.|||:||.:.|:||||||.. 
  Fly    22 ILLVNLSLGATVRRPRLDGRIVGGQVANIKDIPYQVSLQRS-YHFCGGSLIAQGWVLTAAHCTE- 84

  Fly    70 GGGQQSYPAKSYNVRVGSIQRLTGGQLVPLSKIIIHTNYSSSDAVGSN-DLALLELETSVVLNAN 133
              |.....:|   ||:||.:...|||||.:.::..|..:   ||...: |.:|||||.....|..
  Fly    85 --GSAILLSK---VRIGSSRTSVGGQLVGIKRVHRHPKF---DAYTIDFDFSLLELEEYSAKNVT 141

  Fly   134 TNPIDLATERP--AAGSQIIFSGWGSSQVDGSLSHVLQVATRQSLSASDCQTELYLQ----QEDL 192
            ...:.|..:..  |.|:.::.||||::|.....|.||:..|...:|.:.| ||.|..    .:.:
  Fly   142 QAFVGLPEQDADIADGTPVLVSGWGNTQSAQETSAVLRSVTVPKVSQTQC-TEAYGNFGSITDRM 205

  Fly   193 LCLSPVDEDFAGL-------CSGDAGAPASYNNQLVGIAAFFVSGCGSEQPDGYVDVTQHLEWIN 250
            ||        |||       |.||:|.|.:.:..|.|:.::.........|..|..|:...:||:
  Fly   206 LC--------AGLPEGGKDACQGDSGGPLAADGVLWGVVSWGYGCARPNYPGVYSRVSAVRDWIS 262

  Fly   251  250
              Fly   263  262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 75/243 (31%)
Tryp_SPc 30..249 CDD:214473 73/240 (30%)
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 73/238 (31%)
Tryp_SPc 42..264 CDD:238113 75/240 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.