DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and PRSS38

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_898885.1 Gene:PRSS38 / 339501 HGNCID:29625 Length:326 Species:Homo sapiens


Alignment Length:302 Identity:79/302 - (26%)
Similarity:130/302 - (43%) Gaps:68/302 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSPVQSYSHSRLLLLVVI-----------------VTL-GVVQSSR----------LPAEVGSQP 37
            |.|:...:...||||:|:                 ::| |.|...|          :||.....|
Human     8 MGPLGPSALGLLLLLLVVAPPRVAALVHRQPENQGISLTGSVACGRPSMEGKILGGVPAPERKWP 72

  Fly    38 HSISLRRNGVHVCGGALIREKWILTAAHCVSLGGGQQSYPAKSYNVRVGSIQ-RLTGG--QLVPL 99
            ..:|:...|:|||||:::.|.|:|:||||.     .:....|.|::.||.:. |:.|.  |...:
Human    73 WQVSVHYAGLHVCGGSILNEYWVLSAAHCF-----HRDKNIKIYDMYVGLVNLRVAGNHTQWYEV 132

  Fly   100 SKIIIHTNYSSSDAVGSNDLALLELETSVVLNANTNPIDLAT-ERPAAGSQIIFSGWGSSQVDGS 163
            :::|:|..|.....:| .|:||::|:|.:|.:.:..|:.||| |.....:....:|||.....|.
Human   133 NRVILHPTYEMYHPIG-GDVALVQLKTRIVFSESVLPVCLATPEVNLTSANCWATGWGLVSKQGE 196

  Fly   164 LSHVLQVATRQSLSASDCQTELYLQ-------------QEDLLCLSPVDEDFAGLCSGDAGAP-- 213
            .|..||          :.|..|.|:             ..|:||...: .:...:|.||:|.|  
Human   197 TSDELQ----------EMQLPLILEPWCHLLYGHMSYIMPDMLCAGDI-LNAKTVCEGDSGGPLV 250

  Fly   214 ASYNNQ--LVGIAAFFVSGCGSE-QPDGYVDVTQHLEWINEN 252
            ..:|..  .:||.: :..||.:. .|..|..|:...:||.:|
Human   251 CEFNRSWLQIGIVS-WGRGCSNPLYPGVYASVSYFSKWICDN 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 67/243 (28%)
Tryp_SPc 30..249 CDD:214473 65/240 (27%)
PRSS38NP_898885.1 Tryp_SPc 60..291 CDD:238113 67/248 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.