DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and prss60.3

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:XP_002662541.2 Gene:prss60.3 / 335152 ZFINID:ZDB-GENE-030131-7092 Length:330 Species:Danio rerio


Alignment Length:249 Identity:70/249 - (28%)
Similarity:105/249 - (42%) Gaps:52/249 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 AEVGSQPHSISLR--RNGVHVCGGALIREKWILTAAHCVS----------LGGGQQSYPAKSYNV 83
            |..||.|..:||.  :.|.|.|||:||..:|:||||||:|          ||...|.      .:
Zfish    42 ASPGSWPWQVSLHSPKYGGHFCGGSLISSEWVLTAAHCLSGVSETTLVVYLGRRTQQ------GI 100

  Fly    84 RVGSIQRLTGGQLVPLSKIIIHTNYSSSDAVGSNDLALLELETSVVLNANTNPIDLATERP--AA 146
            .:....|       .::|..:|::|:|:  ...||:|||.|.::|.......|:.||.:..  :|
Zfish   101 NIYETSR-------NVAKSFVHSSYNSN--TNDNDIALLRLSSAVTFTNYIRPVCLAAQNSVYSA 156

  Fly   147 GSQIIFSGWGSSQVDGSL--SHVLQVATRQSLSASDCQTEL--YLQQEDLLCLSPVDEDFAGL-- 205
            |:....:|||..|...:|  ..:||......::...|...|  .....:::|        |||  
Zfish   157 GTSSWITGWGDIQAGVNLPAPGILQETMIPVVANDRCNALLGSGTVTNNMIC--------AGLTQ 213

  Fly   206 -----CSGDAGAPASYNNQLVGIAAFFVS---GCGS-EQPDGYVDVTQHLEWIN 250
                 |.||:|.|.......|.:.|...|   ||.. ..|..|..|:|:..||:
Zfish   214 GGKDTCQGDSGGPMVTRLCTVWVQAGITSWGYGCADPNSPGVYTRVSQYQSWIS 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 70/249 (28%)
Tryp_SPc 30..249 CDD:214473 68/246 (28%)
prss60.3XP_002662541.2 Tryp_SPc 36..269 CDD:238113 70/249 (28%)
Somatomedin_B 294..328 CDD:321959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587834
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.