DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and CG4271

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster


Alignment Length:212 Identity:76/212 - (35%)
Similarity:110/212 - (51%) Gaps:18/212 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 NGVHVCGGALIREKWILTAAHCVSLGGGQQSYPAKSYNVRVGSIQRLTGGQLVPLSKIIIHTNYS 109
            :|.|.||||:|..:.:||||.||      ::.|.|...||||:.....||:::.::.:::|.||.
  Fly    39 SGYHECGGAVIDSRIVLTAAQCV------KNKPVKRITVRVGTPDIYRGGRIIRVTALVVHENYK 97

  Fly   110 SSDAVGSNDLALLELETSVVLNANTNPIDLATERPAAGSQIIFSGWGSSQVDG-SLSHVLQVATR 173
            :.|    ||:|||.|| ..||:.....|.|||:.|:.......:|||...::. .::..||....
  Fly    98 NWD----NDIALLWLE-KPVLSVRVTKIPLATKEPSENEYPSNAGWGEKLLESYVVTRKLQNGVT 157

  Fly   174 QSLSASDCQTELYLQ-QEDLLCLSPVDEDFAGLCSGDAGAPASYNNQLVGIAAFFVSGCG-SEQP 236
            :....|.|..||... .|:|||....:.|   :|.||.|.|....|::||||. ...||| :..|
  Fly   158 KIRPRSMCAEELVEPVGEELLCAFYTEND---ICPGDYGGPLVLANKVVGIAV-QGHGCGFAVLP 218

  Fly   237 DGYVDVTQHLEWINENA 253
            ..|.:|..:||||.|||
  Fly   219 SLYTNVFHYLEWIEENA 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 73/209 (35%)
Tryp_SPc 30..249 CDD:214473 71/206 (34%)
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 73/209 (35%)
Tryp_SPc 19..231 CDD:214473 71/206 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25869
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004525
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.