DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and Send1

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster


Alignment Length:267 Identity:72/267 - (26%)
Similarity:111/267 - (41%) Gaps:64/267 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLLLVVIVTLGVVQSSRLPAE--VGSQ-------PHSISLRRNGVHVCGGALIREKWILTAAHCV 67
            |||.|.::...||.....|:|  :|..       |..:||:..|.|.|||::..:..|:|||||:
  Fly     8 LLLAVHLLISPVVPVLLEPSERIIGGSSMDITDVPWQVSLQYYGEHFCGGSIYSKTIIITAAHCI 72

  Fly    68 SLGGGQQSYPAKSYNVRVGSIQRLTGGQLVPLSKIIIHTNYSSSDAVGSNDLALLELETSVVLNA 132
            ..|         ..::|.||....:||.:|.:...|||..:...:.  .||:|:|:|.:.:..:.
  Fly    73 KEG---------ERSIRAGSSLHDSGGVVVGVEAYIIHPQFDKHNM--ENDVAVLKLSSPLSFSD 126

  Fly   133 NTNPIDLATERPAAGSQIIFSGWGSSQVDGSLSHVLQVATRQSLSASDCQTELYLQQEDLLCLSP 197
            :...|.||...|...|..:.:|||...        ..:..||            ||..::| :.|
  Fly   127 SIQTIPLAETDPPTSSSALATGWGRGN--------FLIRPRQ------------LQGVEIL-IRP 170

  Fly   198 V------------DEDFA------GLCSGDAGAPASYNNQLVGIAAFF--VSGCGSEQPDGYVDV 242
            :            :||..      |.|.||:|.|..:|.|||||.:..  :...||..   |..|
  Fly   171 LIVCKLKYGNGVFNEDICAGRMGKGGCYGDSGGPLVFNGQLVGITSRTGNIVCLGSSL---YASV 232

  Fly   243 TQHLEWI 249
            .::..||
  Fly   233 ARYRNWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 66/249 (27%)
Tryp_SPc 30..249 CDD:214473 64/247 (26%)
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 62/244 (25%)
Tryp_SPc 30..239 CDD:238113 62/243 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.