DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and CG1304

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster


Alignment Length:252 Identity:101/252 - (40%)
Similarity:140/252 - (55%) Gaps:14/252 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SRLLLLVVIV--TLGVVQSSRLPAE--VGSQ-PHSISLRRNGVHVCGGALIREKWILTAAHCVS- 68
            |.||||.|.|  ..|.:....:..|  |.:| ||.:|||..|.|.|||:::...::|||||||: 
  Fly    12 SFLLLLAVPVHSAPGSLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAAHCVTN 76

  Fly    69 --LGGGQQSYPAKSYNVRVGSIQRLTGGQLVPLSKIIIHTNYSSSDAVGSNDLALLELETSVVLN 131
              ..|......|:.:.:|.||..|.:||.||.::::|:|..|.:.    .||:|||.||:.::|:
  Fly    77 QDSNGNSVPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGNF----LNDVALLRLESPLILS 137

  Fly   132 ANTNPIDLATERPAAGSQIIFSGWGSSQVDGSLSHVLQVATRQSLSASDCQTELYLQQEDLLCLS 196
            |:..||||.|....|...:|.||||..:..|.|...||..|.:|:|...|...:....:..||| 
  Fly   138 ASIQPIDLPTADTPADVDVIISGWGRIKHQGDLPRYLQYNTLKSISLERCDELIGWGVQSELCL- 201

  Fly   197 PVDEDFAGLCSGDAGAPASYNNQLVGIAAFFVSGCGSEQPDGYVDVTQHLEWINENA 253
             :.|...|.|:||:|.||.||||:||:|.|..|.||:..||||..|..|.|||..|:
  Fly   202 -IHEADNGACNGDSGGPAVYNNQVVGVAGFVWSACGTSYPDGYARVYYHNEWIKNNS 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 92/227 (41%)
Tryp_SPc 30..249 CDD:214473 90/224 (40%)
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 90/227 (40%)
Tryp_SPc 32..256 CDD:238113 92/229 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473222
Domainoid 1 1.000 117 1.000 Domainoid score I5856
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H114140
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7244
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D121264at33392
OrthoFinder 1 1.000 - - FOG0004525
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.