DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and Prss53

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_001074737.1 Gene:Prss53 / 330657 MGIID:2652890 Length:552 Species:Mus musculus


Alignment Length:290 Identity:77/290 - (26%)
Similarity:121/290 - (41%) Gaps:69/290 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QSYSHSRLLLLVVIVTLGVVQSSRL----------PAE----VGSQPHSISLRRNGVHVCGGALI 55
            ||:....|::..|:|..|:..:.|.          |.|    .|..|...|:||.|||:|.|:|:
Mouse     3 QSWRPELLIVGAVVVIEGLQAAQRACGQRGPGPPEPQEGNTLPGEWPWQASVRRQGVHICSGSLV 67

  Fly    56 REKWILTAAHCVSLGGGQQSYPAKSYNVRVGSIQ---RLTGGQLVPLSKIII---HTNYSSSDAV 114
            .:.|:||||||..   ...:....|::|.:||::   :..|.:.|.::.:.:   :.:||.    
Mouse    68 ADTWVLTAAHCFE---KMATAELSSWSVVLGSLKQEGQSPGAEEVGVAALQLPKAYNHYSQ---- 125

  Fly   115 GSNDLALLELETSVVLNANTNP---IDLATERPA----AGSQIIFSGWGSSQVDGSLSHVLQVAT 172
             .:|||||:|         |:|   ..|...:|.    .|:....:||..:..|  :|..|:...
Mouse   126 -GSDLALLQL---------THPTVQTTLCLPQPTYHFPFGASCWATGWDQNTSD--VSRTLRNLR 178

  Fly   173 RQSLSASDCQTELY--LQQE--------DLLC--LSPVDEDFAGLCSGDAGAPASYNNQ-----L 220
            .:.:|...|.. ||  |.|.        .:||  ..|.::   |.|.||:|.|......     .
Mouse   179 LRLISRPTCNC-LYNRLHQRLLSNPARPGMLCGGAQPGEQ---GPCQGDSGGPVMCREPDGHWVQ 239

  Fly   221 VGIAAFFVSGCGSEQ-PDGYVDVTQHLEWI 249
            |||.: |.|.|..|. |....|:..|..|:
Mouse   240 VGIIS-FTSKCAQEDTPVLLTDMAVHSSWL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 70/255 (27%)
Tryp_SPc 30..249 CDD:214473 69/253 (27%)
Prss53NP_001074737.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 27..46 2/18 (11%)
Tryp_SPc 45..271 CDD:238113 68/248 (27%)
Tryp_SPc 311..522 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.