DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4653 and Prss34

DIOPT Version :9

Sequence 1:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster
Sequence 2:NP_848459.1 Gene:Prss34 / 328780 MGIID:2681414 Length:318 Species:Mus musculus


Alignment Length:263 Identity:84/263 - (31%)
Similarity:126/263 - (47%) Gaps:45/263 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LVVIVTLGVVQSSRLPAEVGSQPHSISLRRNGVHVCGGALIREKWILTAAHCVSLGGGQQSYPAK 79
            ||.||....|.:||.|.:|..:.:.:...| ..|.|||:||..:|:|||||||      :....:
Mouse    32 LVGIVGGCPVSASRFPWQVSLRLYDMEHSR-WEHECGGSLIHPQWVLTAAHCV------RPKEVE 89

  Fly    80 SYNVR--VGSIQRLTGGQLVPLSKIIIHTNYSSS-DAVGSNDLALLELETSVVLNANTNPIDLAT 141
            :|.||  ||.::.....||:.:.|||.|..:|.. .|.|..|:|||:|:|.|||:.:..|:.|  
Mouse    90 AYGVRVQVGQLRLYENDQLMKVVKIIRHPKFSEKLSARGGADIALLKLDTRVVLSEHVYPVSL-- 152

  Fly   142 ERPAAGSQII------FSGWGSSQVDGSLS---HVLQVAT-----------RQSLSASDCQTELY 186
              |||..:|.      .:|||..:....|.   |:.:||.           .|:.|:||..|.:.
Mouse   153 --PAASLRISSKKTCWVAGWGVIENYMPLPPPYHLREVAVPIVENNDCEQKYQTNSSSDSTTRII 215

  Fly   187 LQQEDLLCLSPVDEDFAGLCSGDAGAP--ASYNNQ--LVGIAAFFVSGCG-SEQPDGYVDVTQHL 246
              ::|:||......|   .|..|:|.|  ..:|..  .||:.::.: ||| .:.|..|..|..::
Mouse   216 --KDDMLCAGKEGRD---SCKADSGGPLVCRWNCSWVQVGVVSWGI-GCGLPDFPGVYTRVMSYV 274

  Fly   247 EWI 249
            .||
Mouse   275 SWI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 77/248 (31%)
Tryp_SPc 30..249 CDD:214473 75/246 (30%)
Prss34NP_848459.1 Tryp_SPc 35..278 CDD:238113 82/260 (32%)
Tryp_SPc 35..277 CDD:214473 80/258 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.